KEGG   Thalassococcus sp. SH-1: C6Y53_15545Help
Entry
C6Y53_15545       CDS       T05357                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
thas  Thalassococcus sp. SH-1
Pathway
thas00260  Glycine, serine and threonine metabolism
thas00630  Glyoxylate and dicarboxylate metabolism
thas00670  One carbon pool by folate
thas01100  Metabolic pathways
thas01110  Biosynthesis of secondary metabolites
thas01130  Biosynthesis of antibiotics
thas01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C6Y53_15545 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C6Y53_15545 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    C6Y53_15545 (gcvT)
Enzymes [BR:thas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     C6Y53_15545 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AVO38982
UniProt: A0A2S0MSY9
Position
3178422..3179543
Genome map
AA seq 373 aa AA seqDB search
MTDLRRTPLYDLHTELGARMVPFAGYEMPVQYPLGVMKEHLHTRAAAGLFDVSHMGQVIV
RASGYEAAALAMEALVPASIAGLGEMRQRYGFFTNNAGGISDDLMLANRGDHLFVVVNAA
CREADIAHMRAGLAGCEIDEITDRALLALQGPQAEAVLEALVPGAAAMRFMDVAILGSDW
GELWLSRSGYTGEDGYEISVPDAQAEALARRLLADDRVEAIGLGARDSLRLEGGLCLYGN
DIDATTTPVEAALDWAIQKIRRRGGVREGGFPGAEIILDQLENGTARRRVGLRPDGRAPM
REGTPLFASAAGGDPVGQVTSGGFGPSVGGPVAMGYVGADHAAPGTALFGEVRGKRLPVT
VSELPFVAANFKR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacggatctcaggcgcacgccgctttacgacctgcacaccgaactgggggccaggatg
gttccctttgccggctatgaaatgccggtgcagtatccgctcggggtgatgaaggagcat
ctgcatacccgcgcggcggccgggctgttcgacgtgtcccacatggggcaggtgatcgtg
cgcgcgtccggctacgaggcggccgcgctggcgatggaggcgctggtgcctgccagcatc
gccgggctcggcgagatgcgccagcgctacgggttctttaccaataatgccggcgggatc
agcgacgacctgatgctggccaaccggggcgaccacctgttcgtcgtggtcaacgccgcc
tgccgcgaggccgacatcgcccatatgcgcgccgggctggccgggtgcgagatcgacgag
atcaccgaccgcgcgctgctggcgttgcaggggccgcaggccgaggcggtgctggaggcg
ctggtgcccggcgcggcggcgatgcggttcatggatgtcgccatcctcggcagcgactgg
ggcgagctgtggctgtcccggtccggatataccggcgaggacggctatgagatctcggtg
cccgacgctcaggccgaggcgctggcgcgcaggctgctggccgacgaccgggtcgaggcg
atcgggctgggcgcgcgcgattcgctgcggctcgaaggggggctgtgcctctacggcaac
gacatcgacgccaccaccacgcccgtcgaggcggcgctggactgggcgatccagaagatc
cgccgtcgcggcggcgtccgcgagggcgggtttccgggcgcggagatcattctggaccag
ttggaaaacggcacggcgcggcgtcgggtcgggctgcgccccgatggccgtgcaccgatg
cgcgaaggcacgccgctgttcgcgtcggccgctggcggcgacccggtggggcaggtgaca
tccggcggtttcggccccagcgtcgggggtccggtcgcgatgggatatgtcggcgccgat
cacgccgctcccggcaccgcgctgttcggcgaggttcgcggcaagcggctgccggtcacg
gtttcggaactgcccttcgtggcggcgaatttcaaacgatag

DBGET integrated database retrieval system