KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_13500Help
Entry
TCCBUS3UF1_13500  CDS       T01866                                 

Definition
(GenBank) Uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00860  Porphyrin and chlorophyll metabolism
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01120  Microbial metabolism in diverse environments
Module
thc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:thc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TCCBUS3UF1_13500
Enzymes [BR:thc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     TCCBUS3UF1_13500
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     TCCBUS3UF1_13500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 CysG_dimeriser Sirohm_synth_M Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AEV16392
UniProt: G8NDZ1
Position
1344690..1345334
Genome map
AA seq 214 aa AA seqDB search
MGYFPLMLDLRGKPVLLVGGGPETPQKLRALLEAGAEVTVLAQEDPGDLEALAQEGRIRW
VRRGYRRGDLEGFFLVVSHPKDKAIHPEVRREAEERRIFLVAVDDPENASAILPAVLRRG
ELVVALSTSGAAPALAVRLKERFAALLPLAYGELVAYLRTLRPRIAQIPDFEARKRLWYR
IVDQALEALDLDPKEGLPKAMAKAEAALEEVWTR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgggctacttccccctgatgctggacctccgcggcaagcccgtcctcctcgtcggcggc
gggcccgagacgccgcaaaagctcagggccttgctggaagccggggccgaggtcaccgtc
ctggcccaggaggacccgggggacctcgaggccctggcccaggagggccgcatccggtgg
gtgcggcggggctaccgaaggggggacctggagggctttttcctggtggtaagccacccc
aaggacaaggccatccaccccgaggtgcggcgggaagcagaggaaaggcgcatcttcctg
gtggcggtggacgacccggaaaacgccagcgccatcctccccgcggtgctgcgccggggg
gagctggtggtggccctttccacctcgggggccgcccccgccctggcggtgcgcctcaag
gagcggtttgccgcccttttgcccctggcttacggggaactcgtggcctacctccgcacc
ctaaggcccaggatcgcgcaaatcccggactttgaggcgaggaaacggctttggtaccgc
atcgtggaccaagccctggaagcattggacctagaccctaaggaaggcctgcccaaggcc
atggccaaggctgaagccgccctggaggaggtatggacaaggtaa

DBGET integrated database retrieval system