KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_15030Help
Entry
TCCBUS3UF1_15030  CDS       T01866                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00340  Histidine metabolism
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01230  Biosynthesis of amino acids
Module
thc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    TCCBUS3UF1_15030
Enzymes [BR:thc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TCCBUS3UF1_15030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEV16544
UniProt: G8N8F8
Position
complement(1497732..1498970)
Genome map
AA seq 412 aa AA seqDB search
MIYRAEEVRERFARRGLSFDPKVEEVVRGILEAVRAEGDAALDRFSLDLDGHPVEEIPKR
AWRQAYEDLDEALRDALETAKERIEAFYREEAKGGFLKADAAGVLGQLVRPLARVGVYVP
GGSAPLLSSLLMSVIPAKVAGVGEVIVASPPRVHPGVLAAAWVAGADRLFAMGGAQAIAA
LAYGTARVPRVDKIVGPGNAYVVAAKRQVYGVVGLDGLAGPTETMLVADGSASPKLLAAD
LLAQAEHGPDSEPWLLSPDRALLERVEAELYRQLQDLPRAEMARKALERGGLVLTQDLEE
ALALANLYAPEHLCLALADPLPWLGKVQNAGGVFLGEGSPEALGDYIAGPSHVMPTSGTA
RFQGGLAVRDFLKVIPVIGLGEKAVRELSAKGAVLARAEGLEGHARSLDLRQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccgcgcggaggaggtgagggagcgcttcgcccggcgggggctctcttttgac
cccaaggtggaggaggtggtgcggggcatcctcgaggcggtgcgggcggaaggggatgcc
gccttggaccgcttcagcctggacctggacggccaccccgtggaggagatccccaagcgc
gcctggcgccaggcctacgaggacctggacgaggccctgcgggatgccctggaaaccgcc
aaggagcgcattgaggccttctaccgcgaggaggccaagggcggcttcctgaaggcggat
gcggccggggtcctgggccagctggtgcggcccctggcccgggtaggggtctacgtgccc
gggggaagcgccccccttctttccagcctcctcatgagcgtgattcccgccaaggtggcc
ggggtgggggaggtgatcgtggccagcccccctagggtccaccccggggtgctggccgcg
gcctgggtggcgggggcggaccggcttttcgccatgggcggggcccaggccatcgccgcc
ctggcctacggcaccgcccgcgtgccccgggtggacaagatcgtgggccccgggaacgcc
tacgtggtggcggccaagcgccaggtctacggggtggtgggcctggacggcctggcgggt
cccacggagaccatgctggtggccgatggttccgcctcgcccaagctccttgccgccgac
ctcctggcccaggcggagcacgggcccgactccgagccctggctcctctccccggatagg
gccctcctagagcgggtggaggcggagctctaccgccagcttcaggacctcccccgggcg
gagatggcccggaaggccctggagcggggggggctggttctcacccaggacctggaggag
gccttggccctggccaacctctacgcccccgagcacctctgcctggccctcgccgaccct
ttgccttggcttggcaaggtgcaaaacgccggcggggtcttcctgggggagggaagccct
gaggccctgggggactacatcgccggccccagccacgtgatgcctacctcgggcacggcc
cgcttccaggggggcttggccgtgcgggactttctcaaggtgatcccggtgatcggcctg
ggggagaaggcggtgcgggagctttccgccaagggggcggttctggcccgggccgagggc
ctggaggggcatgcccgttccctggacctaaggcaatga

DBGET integrated database retrieval system