KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_16700Help
Entry
TCCBUS3UF1_16700  CDS       T01866                                 

Definition
(GenBank) Succinate dehydrogenase, membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00020  Citrate cycle (TCA cycle)
thc00190  Oxidative phosphorylation
thc00650  Butanoate metabolism
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01120  Microbial metabolism in diverse environments
thc01130  Biosynthesis of antibiotics
thc01200  Carbon metabolism
Module
thc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
thc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
thc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TCCBUS3UF1_16700
   00650 Butanoate metabolism
    TCCBUS3UF1_16700
  Energy metabolism
   00190 Oxidative phosphorylation
    TCCBUS3UF1_16700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF3220
Motif
Other DBs
NCBI-ProteinID: AEV16711
UniProt: G8N9D5
Position
complement(1671052..1671447)
Genome map
AA seq 131 aa AA seqDB search
MAIKSKRYAEARLEANTNLELYWWVFMRISGVVLVFLLIGHMWMNAILMDLNKIDYDYVA
QRLSQTTWKIYDWLILALALLHGANGLRYVLDDWVRDPAKRFWTKVVAYGLIGFLFLLGS
LSLFNHDFGVK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaagtccaagcggtatgctgaggccaggctcgaggccaacaccaacctggag
ctttactggtgggtcttcatgcgcatctccggggtggtcttggtcttcttgctcatcggc
cacatgtggatgaacgccatcctcatggacctcaacaagattgactacgactacgtggcc
cagagactttcccagaccacctggaagatctacgactggctcatcctggccctggccctc
ctgcacggggccaacgggctccgctacgttctggacgactgggtgcgggacccggccaag
cgcttctggaccaaggtggtggcctacggcctcatcggcttcctcttcctcttgggcagc
ctttcccttttcaaccatgattttggggtgaagtag

DBGET integrated database retrieval system