KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_17590Help
Entry
TCCBUS3UF1_17590  CDS       T01866                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00260  Glycine, serine and threonine metabolism
thc00750  Vitamin B6 metabolism
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01120  Microbial metabolism in diverse environments
thc01230  Biosynthesis of amino acids
Module
thc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TCCBUS3UF1_17590
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TCCBUS3UF1_17590
Enzymes [BR:thc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TCCBUS3UF1_17590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AEV16798
UniProt: G8N9V2
Position
complement(1762270..1763361)
Genome map
AA seq 363 aa AA seqDB search
MTLGGEREKHIPMRLPLMERYRAHLPVSSGTPVVSLLEGSTPLVPLKGPEEARRQGVRLF
AKLEGLNPTGSFKDRGMTLAVSKAVEAGAKAVAAASTGNTAASAAAYAARAGIGAIVVLP
AGYVALGKVAQSLVHGARIVQVEGNFDQALALTKALTEAYPVALVNSLNPYRLEGQKTLA
FEVVDELGDAPHYHALPVGNAGNITAHWMGYKEYHALGKASRLPRMLGFQAAGAAPLVLG
RPVERPETLATAIRIGHPASWEGALRAKEESGGRIEAVSDEEILAAYRYLAEVEGIFVEP
ASAAAMAGVWKLLREGALEAGSQVVLTLTGHGLKDPATAERVARLAPPVPATLSAVAEAA
GLL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcttgggggggaaagggaaaagcatattcccatgcgcctgcccctgatggagcgt
taccgcgcccacctaccggtttcctccggtaccccggtggtctccctcctggagggttcc
acccccctggtccccctgaagggccccgaggaggccaggcggcaaggggtaaggctcttc
gccaagctggagggcctgaaccccacggggagcttcaaggaccgagggatgaccctggcg
gtctccaaggcggtggaggcgggggccaaggccgtggcggcggccagcacggggaacacc
gccgccagcgccgccgcctacgccgcccgggcggggatcggggccatcgtggtcctcccc
gcggggtacgtggccctgggcaaggtggcccagagcctggtccacggggcccgcatcgtc
caggtggaggggaactttgaccaggccctggccctcaccaaggccctcaccgaggcctac
cccgtggccctggtcaactccctgaacccctaccgcctggaggggcagaagaccctggcc
tttgaggtggtggacgagctgggggatgccccccactaccacgccctgcccgtggggaac
gcggggaacatcaccgcccactggatggggtacaaggagtaccacgccctgggcaaggcc
agccgcctgccccggatgctgggcttccaggccgcaggggccgcccctttggtcctgggc
cgtccggtggagaggccggagaccctggccacggccatccgcatcggccaccccgccagc
tgggaaggggccctgcgggccaaggaggagtcgggagggcggattgaggcggtcagcgac
gaggagatcctggccgcctaccgctacctggccgaggtggaggggatcttcgtggagccc
gccagcgccgcggccatggccggggtctggaagctcctgagggaaggggccctggaggcg
ggaagccaggtggtcctcaccctcaccggccacggcctcaaggacccggccacggcggaa
agggtggccaggcttgctccccccgtgcccgccaccctttcggcggtggccgaggccgcg
ggcctcctgtga

DBGET integrated database retrieval system