KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_19030Help
Entry
TCCBUS3UF1_19030  CDS       T01866                                 

Definition
(GenBank) Pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00790  Folate biosynthesis
thc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TCCBUS3UF1_19030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thc04147]
    TCCBUS3UF1_19030
Enzymes [BR:thc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     TCCBUS3UF1_19030
Exosome [BR:thc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TCCBUS3UF1_19030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AEV16941
UniProt: G8NAQ4
Position
1910348..1910584
Genome map
AA seq 78 aa AA seqDB search
MDWEVRQDPERLYKAFRFPDFREALAFANRVGELAEAHHHHPRLTVEWGRVAVEWWTHSA
GGITEKDREMARLTDLLG
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggactgggaggtacggcaggatcccgagcggctttacaaggccttccgcttccccgat
ttccgcgaggccctggccttcgccaaccgggtgggggagctggccgaggcccaccaccac
caccctaggctcaccgtggagtgggggcgggtggccgtggagtggtggacccatagcgca
ggggggatcacggagaaggaccgggagatggcccgccttaccgacctcctggggtag

DBGET integrated database retrieval system