KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_20450Help
Entry
TCCBUS3UF1_20450  CDS       T01866                                 

Definition
(GenBank) Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00010  Glycolysis / Gluconeogenesis
thc00020  Citrate cycle (TCA cycle)
thc00620  Pyruvate metabolism
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01120  Microbial metabolism in diverse environments
thc01130  Biosynthesis of antibiotics
thc01200  Carbon metabolism
Module
thc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCCBUS3UF1_20450
   00020 Citrate cycle (TCA cycle)
    TCCBUS3UF1_20450
   00620 Pyruvate metabolism
    TCCBUS3UF1_20450
Enzymes [BR:thc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TCCBUS3UF1_20450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AEV17083
UniProt: G8NBK6
Position
2043328..2044689
Genome map
AA seq 453 aa AA seqDB search
MPKEILMPELAESVVEGEILKWLVAEGDYLKKDQPFVEVMTDKVTVELPSPYEGVLVKKL
AREGEVVKVHAPIALLAEPGEGVEPPVQAREERSIVEPGLPAKEEKEDLSLFKPDPTQVA
VKNPFLSTPPTPEAPKGPGGRVLAVPAARKLARELGIPIEAVPGSGPLGRVRVEDVRAYA
AKQGASRPAPPPQEAPKEAPSLPPGFPPPPRYTPPKGYEGLEERVPLRGIRRTIAHGLWQ
SHLYTVRTLNVDEADLTELVALRERLKPEAERQGVRLTYLPFIAKAVVRALKKFPMLNAS
LDEERQEIVYKRYYHLGLAVATERGLIVPVLRDADRKSILELAQEITELSAKAREGRLSP
EEVTGSTFTITNIGSVGATLSFPIINLPEAAILGVHSIRKRPWVMPDGSIQARDIMYLSL
SFDHRLVDGAEAARFTREVIRLLENPEVLLLEM
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggaaatcctcatgcccgaactcgccgaaagcgtggtggaaggcgagatcctc
aagtggctggtggcggaaggggactacctcaagaaggaccaacccttcgtggaggtgatg
acggacaaggtgacggtggagctcccctccccctacgaaggggtgctggtgaaaaagctg
gcgagggagggggaggtggtcaaggtccacgcccctatcgccctcctcgccgagccgggg
gaaggggtggaaccccctgtgcaggcccgggaggagcgctccatcgtggagccggggttg
cccgccaaggaggaaaaggaggacctctccctcttcaagcccgaccccacccaggtggcg
gtgaaaaaccccttcctctccaccccccctacccccgaagcgcctaagggtcccgggggg
cgggtcctggccgtccccgccgcccgcaagctggcccgggagctagggatccccatagag
gccgtgcccggctccgggcccttaggaagggtgcgggtggaggacgtgcgggcttacgcc
gccaagcagggggcctcgaggccagccccacccccccaggaagcccccaaggaggccccc
agcctccctccaggcttccctcccccgccccggtacaccccccccaaggggtacgagggg
ctggaggagcgcgtccccctaaggggaatccgccgcaccatcgcccatggcctctggcaa
agccacctctacaccgtgcgcaccctcaacgtggacgaggccgacctcacggagctggtg
gccctgcgggagcgcctgaagcccgaggccgagcgccagggggtaaggctcacctacctg
cccttcatcgccaaggcggtggtgcgggccctgaagaagttccccatgctcaacgccagc
ctggacgaggagcggcaggagatcgtctacaagcgctactaccacctgggcctagccgtg
gccacggaacgggggctcatcgtccccgtgttgcgggatgcggaccggaaaagcatcctg
gaactcgcccaggagatcaccgagctctcggccaaggcccgggaggggcggctttcccct
gaggaggtgacgggctccaccttcaccattaccaacatcggctccgtgggggccaccctg
agcttccccatcatcaaccttcccgaggccgccatcctgggggtgcactccatccgcaag
cgcccctgggtcatgcccgatggctccatccaggcccgggacatcatgtacctctccctt
tcctttgaccaccgcctggtggacggggccgaggcggccaggttcacccgggaggtgatc
cggcttttggagaaccccgaggttctcctcctggaaatgtag

DBGET integrated database retrieval system