KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_8370Help
Entry
TCCBUS3UF1_8370   CDS       T01866                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00010  Glycolysis / Gluconeogenesis
thc00620  Pyruvate metabolism
thc00640  Propanoate metabolism
thc00680  Methane metabolism
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01120  Microbial metabolism in diverse environments
thc01130  Biosynthesis of antibiotics
thc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCCBUS3UF1_8370
   00620 Pyruvate metabolism
    TCCBUS3UF1_8370
   00640 Propanoate metabolism
    TCCBUS3UF1_8370
  Energy metabolism
   00680 Methane metabolism
    TCCBUS3UF1_8370
Enzymes [BR:thc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TCCBUS3UF1_8370
Lipid biosynthesis proteins [BR:thc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TCCBUS3UF1_8370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N PapJ
Motif
Other DBs
NCBI-ProteinID: AEV15884
UniProt: G8NBS2
Position
complement(817513..819390)
Genome map
AA seq 625 aa AA seqDB search
MEKLLKEEERLWAPEALRQGANLQDFWAEYRRSLEDPEGFWGEWARRFHWETPFQKVLEW
NLPEHRWFLGGRTNVVYNALERNVARGLRNKVALLYLGEDGQEAKLTYGELLDRVRRLAT
GLKRLGVGPGDRVVLYMPLTLEGVMAMLATAYLGAIHSVVYAGLGVSALRERILDAGAKL
LIAGDVSYRRGKGVDLRSIVEEAIKDLPLEVVWFQRAYKAELPPGHHDFQELLWNNPPEA
RAEMVEAEHPLFILYTSGSTGKPKGVVHAHGGYMVGTTYHLRTFFDAKDEDVFWATSDIG
WIVGHSYIVYAPLLEGLTSVLREGAPDYPDPGAFWQVVERYRVNIMFTAPTAVRLFMKYG
PEWPARYDLSSLRLVAVAGEPLNPEALRWAYRHLVEEGRRGFVADNWWQTELGGPTLGTP
LNLPAKPGFAGVALPGVEAEVVDEEGRPVPPGQGGLLVLKRPFPHMMRTVWGDHGRYLQY
WREVPGGVYAAGDVASRDEEGYFSVLGRADDVLNVAGHRIGTADVESALVSHPAVAEAAV
IGVPDPLKGEAIKAFVVLRLGQAPSEALKESLVAHVRRELGPIATPSEVVFLDKLPKTRS
GKILRRLLRARELGKDPGDLSTLEE
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaagcttcttaaggaggaagagcggctttgggcccccgaggccctgcgccaaggg
gccaacctgcaggacttctgggcggagtaccggcggagcctcgaggaccccgagggcttc
tggggggagtgggccaggcggttccattgggaaacgcctttccaaaaggttctggagtgg
aacctccccgagcaccgctggttcctgggaggcaggaccaacgtggtctacaacgccctg
gagaggaacgtggcccggggcctgaggaacaaggtggccctcctctacctaggagaggac
ggccaggaggccaagctcacctatggggagcttctggaccgggtacgccgcctagccacc
gggctgaagcgcctaggggtgggcccgggggaccgggtggtcctctacatgcccctcacc
ctcgagggggtgatggccatgctggccaccgcctacctgggggccatccacagcgtggtc
tacgccgggcttggggtttccgccctgcgggagaggatcctggacgccggggccaagctc
ctcatcgccggggacgtgagctaccgccggggcaagggggtggacctccgctccatcgtg
gaggaggccatcaaggaccttcccctggaggtggtctggttccagcgggcctacaaggcg
gaactccccccgggccaccacgacttccaggaacttctctggaataatcccccagaggcc
cgggcggagatggtggaggcggaacaccccctcttcatcctctacacctcggggtccacg
ggcaaacccaagggggtggtccacgcccacggggggtacatggtgggcaccacctaccac
ctgcgcaccttcttcgacgccaaggacgaggacgtcttctgggccaccagcgacatcggc
tggatcgtgggccactcctacatcgtctacgcccccctcctggaaggcctcacctccgtc
cttcgggaaggggccccggactaccccgaccccggggccttctggcaggtggtggagcgg
taccgggtgaacatcatgttcaccgcccccaccgcggtgcgcctcttcatgaagtacggg
cccgagtggccggcccggtacgacctctcctccttgcgcctggtggccgtggccggcgag
cccctgaaccccgaggccctccgttgggcctaccgccacctggtggaggagggccggcgg
gggtttgtggccgacaactggtggcagacggagctgggcgggcccaccttgggcaccccc
ttgaaccttccggccaaaccgggcttcgccggggtggccctccccggggtggaggcggag
gtggtggacgaggaggggaggcccgtcccccccggccaagggggcctcctggtcctgaag
cggccttttccccacatgatgcgcaccgtctggggggaccacgggcgctacctgcagtac
tggcgggaggtgcccgggggggtgtacgccgctggggacgtggccagccgggacgaagag
gggtacttcagcgttctgggccgggcggatgacgtcctcaacgtggccgggcaccgcatc
ggcaccgcggacgtggaaagcgccctggtctcccaccccgcggtggccgaggccgcggtg
atcggggtgcccgaccccctcaaaggggaggccatcaaggccttcgtggtgctccgcctg
gggcaagcaccctcggaggccctgaaggaaagcctggtggcccacgtgcgccgggaactg
ggccccatcgccacccccagcgaggtggtcttcttggacaagctccccaagacccgctcg
ggcaagatcctccgccgcctgctccgggcccgggagctggggaaggaccccggggacctc
tccaccctcgaggagtaa

DBGET integrated database retrieval system