KEGG   Thermococcus sp. 4557: GQS_03295Help
Entry
GQS_03295         CDS       T01588                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
the  Thermococcus sp. 4557
Pathway
the00790  Folate biosynthesis
the01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GQS_03295
Enzymes [BR:the01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     GQS_03295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD QRPTase_C DUF561
Motif
Other DBs
NCBI-ProteinID: AEK72560
UniProt: G0HN52
Position
632029..632847
Genome map
AA seq 272 aa AA seqDB search
MKFAGIDLSEPRIMGVINVSPESFYKGSVRDDGEGLIETAVKMVEDGATFIDIGAKSTAP
YLETQIPVEEEVRRAVWAVKAIRDHVDVPISIDTTSARVAEEALKAGADVINDVTGLKGD
AKMAEVATEYTAPVIVCAHGEVRNLSDPIHTVVDLLQGSIVIAEKHGIEEVAIDPAIGFL
RPEWPPWYEWDSKVLANLNMLKIFGRPILIGVSRKSFIGAITDRKDPLERLPGSLAATAV
AIFNGANIIRTHDVRETLDAVKMATFMRKFRM
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgcggggattgacctgagtgagcccaggataatgggcgtcatcaacgtttcg
cctgagagcttctacaaggggagcgtcagggacgacggggaggggctcatcgagaccgcg
gtgaagatggttgaggacggcgctaccttcatcgacatcggtgccaaatccacagccccc
tacctcgagacccagattccagttgaggaggaggtaaggcgggcggtatgggcggttaag
gccattcgcgaccacgtggacgtgccgataagcatagacacaacgagtgccagggtcgcg
gaggaggccctgaaggcgggcgcggatgtgataaacgacgtcaccggcctgaagggagac
gcgaagatggcggaggtcgcgactgaatataccgccccggtgatagtctgcgcccacggg
gaggtgaggaacctcagcgacccgattcataccgtggtggacctcctgcagggaagcata
gtcatagccgagaagcatggtatcgaggaggtagccatagacccggccataggcttcctc
cgcccggagtggcccccctggtacgagtgggactcaaaggttctggcgaaccttaacatg
ctcaaaatcttcggacggcccatcctcataggggtctccaggaagtcgttcatcggggcg
ataactgacagaaaagaccccttggagaggctcccggggagccttgccgccacggcggtg
gccatcttcaacggggcgaacataatcaggacacacgacgtcagggaaacactcgatgcc
gttaagatggcaacgttcatgaggaagttccggatgtag

DBGET integrated database retrieval system