KEGG   Thermococcus sp. 4557: GQS_05880Help
Entry
GQS_05880         CDS       T01588                                 

Definition
(GenBank) magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
the  Thermococcus sp. 4557
Pathway
the00860  Porphyrin and chlorophyll metabolism
the01100  Metabolic pathways
the01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GQS_05880
Enzymes [BR:the01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     GQS_05880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase MCM AAA_5 VWA AAA_29 AAA AAA_22 AAA_16 DUF815 TIP49 TsaE Mg_chelatase_C PAT1 AAA_30 AAA_28 ABC_tran NACHT
Motif
Other DBs
NCBI-ProteinID: AEK73076
UniProt: G0HJE7
Position
complement(1098640..1100553)
Genome map
AA seq 637 aa AA seqDB search
MEPREKRLVFPFSAIVGQEKAKLALLAVAVNPLIGGVLLKGDKGTGKSTLVRALANVLPE
IEVVADCPFNCNPGNPLEMCDSCYERYERGEGLPVAKRKMRVVDLPLSVTIDRLVGTVDV
ERFLKEGKKALQPGILAEANRNVLYIDEVNLLDDYIADSLLDAAAMGWNTIEREGISFRH
PARFILVGSMNPEEGELRPQILDRFGLCVEVSAPMNPEERIEIVKRVEEFHEDPINFYKK
YESEEKKLTERIVKAREVLPKVEISDDLLKLLAETVVNLGIKTNRAEIATIKTAKAIAAL
NGRRRVSLEDLEKAMELALPHRLRDRPFQKPPQMRPPKPKDDREHNQDHKHHHKHEHKKG
EKSGSARSRGTGNLEQNFRSSEAKIPGIESKNFDGGEFTGYRSSRDVSVTVINFPKGVPV
SYLPPTNGKIKDVDFYNSLVWAALNGKKPPIKLNLKDVRVRVRKAKAPTLWVLLLDSSGS
MAVQKRISIAKGIAEKLVENGYIKKSKMAMIVAKGNQAEIFVPPTKNYWEVLEKIESVPT
GGRTPLSSALYNLLLLANRERMKDRSVKVRAFLITDGKANVPLFGRRIKEEITELARALK
KREIELTVYDTRGRGISPGLSYVPILERVAGAKVHKV
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcgtgaaaaacgattagtcttcccgttctccgcaatagtcgggcaggaaaag
gccaagctggcactgctggccgtggccgttaatccactgattggtggtgtcctgcttaaa
ggagataagggaacgggaaaatcgaccttagttagggctctggccaacgtcttgcccgag
attgaagttgtggcggactgtcccttcaactgcaatccggggaacccgctggagatgtgc
gacagctgttatgagaggtatgagcggggagaaggactgccagtggcaaagaggaagatg
cgcgttgtggacctgcccctcagtgttaccatagacaggctcgttggaaccgttgatgtg
gagcgctttttaaaggagggcaaaaaagctctgcagccgggaatactagcggaagcaaac
agaaacgtgctctacattgatgaggtcaacctcctggacgactacatagccgattcactc
ttagatgctgcagcaatgggatggaacactatagagagggagggaatctccttcaggcat
ccggcgaggttcatcctggttggaagcatgaacccagaggaaggcgagctcagaccgcag
atcctcgacaggttcggtttatgcgttgaagtttcagcacctatgaacccggaggagagg
atagagatagtcaagcgcgttgaggagttccatgaagaccccataaacttctacaaaaaa
tatgagagcgaagagaagaagctcacggagaggatcgttaaggcgagggaggttctgccg
aaggtcgagataagcgacgatttgctgaagcttttggctgaaacggtcgttaacctggga
atcaaaaccaacagggccgagatagccacgataaagacggccaaagcgatagccgcccta
aacgggaggagaagggtctcactggaagacttagaaaaagctatggaattagctttaccg
caccgcctgagggacaggccgttccaaaagccgccccagatgaggcccccaaagcctaaa
gatgatagggagcacaatcaagatcataagcaccaccacaagcatgagcacaagaaggga
gaaaaaagtggaagcgctcgaagtcgaggaactggaaacttagagcagaattttcgctcg
agcgaggctaaaatcccggggatagaaagcaaaaactttgatggaggcgaattcacggga
taccggtcctcaagggacgtcagcgttacagtaataaacttccccaaaggcgttccagtt
tcgtatctcccaccaaccaacggcaaaattaaagacgttgatttttacaactctctggtt
tgggcagctctgaatggaaaaaagcctccaataaagcttaatttaaaggacgttcgtgtt
agggtcaggaaggcaaaggcaccaacgctctgggttttgctcctggattcgagcggaagc
atggccgtgcagaagaggataagcattgcgaagggaatagcggagaaattggttgagaac
ggctacatcaaaaagtcaaagatggccatgatcgttgcgaaaggtaaccaggcggagata
tttgttccacccactaagaactactgggaagtgcttgagaaaatagagagcgttccgact
ggagggaggacacctttaagctctgccctctacaatcttttgcttttggcgaacagggag
aggatgaaggaccggtcggtcaaggtgagggcttttctaataaccgacggaaaggcaaac
gtgccgctctttggaaggaggattaaggaggaaataacggagcttgccagggcgctgaaa
aagagggagattgagctcacggtttatgacacgagaggaagggggataagcccgggcctg
tcctatgtccccatcctggagcgggttgccggggcaaaggtgcataaagtttag

DBGET integrated database retrieval system