KEGG   Thermaerobacter sp. FW80: E1B22_10285Help
Entry
E1B22_10285       CDS       T05930                                 

Definition
(GenBank) TenA family protein
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
thef  Thermaerobacter sp. FW80
Pathway
thef00730  Thiamine metabolism
thef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thef00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    E1B22_10285
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:thef03000]
    E1B22_10285
Enzymes [BR:thef01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     E1B22_10285
Transcription factors [BR:thef03000]
 Prokaryotic type
  Other transcription factors
   Others
    E1B22_10285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: QBS38082
UniProt: A0A4P7GUU3
Position
complement(2469187..2469855)
Genome map
AA seq 222 aa AA seqDB search
MHPGTAHPPASGDGGGTGLAAQLWRQNLDVARRCLEHPFVQGLGRGDLPRDRFAWYVGQD
ANFLEAFARAYALALAKAPDLETMTALRDLLEGVLDELRLHQGYAARWGVDLRPAPALAT
RAYTGFVLDVAWSRPLGAIAAAMTPCMRLYAYLGRSLADRVTPDNPYREWVTTYGSPAFE
GLARRLEALLDRWHPGVEDVAALYRTAMELEFAFFDAAWRAA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcatccggggacggcccatcccccggcgtcgggggacggcggcgggacggggttggcc
gcgcagctctggcggcagaacctggacgtggcgcgacggtgcctcgagcaccccttcgtc
cagggcctgggacggggcgacctaccccgggaccgcttcgcctggtacgtcgggcaggac
gccaacttcctcgaggccttcgcccgcgcctacgccctcgccctggccaaggcgcccgac
ctggagaccatgacggcccttcgcgacctcctggagggggtgctggacgagctccgcctg
caccagggttacgccgcgcgatggggggtcgacctgcggccggccccggccctggccacg
cgggcgtacaccggcttcgtcctggacgtggcgtggtcgcggccgctgggggccatcgcc
gcggccatgaccccgtgcatgcgcctgtacgcctacctggggcgctcgctggccgatcgg
gtgacacccgacaacccgtatcgcgagtgggtgaccacctacgggagccccgccttcgaa
gggctggcccggcggctggaggccctgctggaccgctggcaccccggcgtcgaggacgtg
gccgcgctgtatcggacggccatggagctcgagttcgccttcttcgatgcggcctggcgg
gcggcctga

DBGET integrated database retrieval system