KEGG   Thermaerobacter sp. FW80: E1B22_12535Help
Entry
E1B22_12535       CDS       T05930                                 

Definition
(GenBank) hypothetical protein
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
thef  Thermaerobacter sp. FW80
Pathway
thef00860  Porphyrin and chlorophyll metabolism
thef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thef00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    E1B22_12535
Enzymes [BR:thef01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     E1B22_12535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3
Motif
Other DBs
NCBI-ProteinID: QBS38732
UniProt: A0A4P7GWG6
Position
unnamed1:complement(76914..77426)
Genome map
AA seq 170 aa AA seqDB search
MPGKTARGQAIWEAGAGAGRWGNRRSWTLPWCACPAQPGVRVRYVASPDERAVQCRDPAG
NQKHRGRPGMAVSQRLGPGHRPGGGGEASLMGMCAGYQMLGLRVRDPRGAEASIGEVRGL
AYLPVGAELQPVKTTRRRSVHVAPGGSGFWDQCAGAELEGYEIHMGVTRW
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcaagacagcgcgagggcaggcaatctgggaagcgggggcgggcgcggggagg
tgggggaaccggcggtcctggaccttgccgtggtgcgcctgccccgcccagccgggggtg
cgtgtccgctacgtcgcgtcgccggacgagcgggcagtccaatgccgtgatcctgccgga
aaccaaaagcaccgtggaagacctggtatggctgtttcgcaacggcttggaccgggccat
cgcccgggcggtggtggggaggcgtcgctgatgggcatgtgcgccgggtaccagatgctg
ggtctgcgcgtccgcgatccccgcggggccgaggcaagcattggcgaggtgagggggctc
gcttacctaccggtaggggcggagctgcaacccgtcaagaccacgcgccgccggtcagtg
catgtggcccccggcgggtccggcttctgggaccaatgcgccggtgcggagttggaaggg
tacgagatccacatgggggtgacgcggtggtga

DBGET integrated database retrieval system