KEGG   Thermosipho sp. 1070: Y592_00855Help
Entry
Y592_00855        CDS       T04909                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ther  Thermosipho sp. 1070
Pathway
ther00051  Fructose and mannose metabolism
ther01100  Metabolic pathways
ther01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ther00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Y592_00855
Enzymes [BR:ther01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Y592_00855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ANQ53085
Position
complement(171607..172245)
Genome map
AA seq 212 aa AA seqDB search
MKEEILRAVRFIVENGLVKGTWGNVSIRDKDYVYITPSGIPYDKLKEEMISVVDFNGRLI
DGLKPSSELPTHLEIYKNRKDVNAIVHTHPVFSTTVSVVSSEIPPLIEDAVMILGPEIKV
SEYALPGSIELAKNVVDALSDNNAVILKNHGLITVGFDIDEALTASLVCEKTAEIYLYTL
NIGNFSTISYEDAVILRNKYLNGYRQIKKDIG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagaaatattaagagctgttagatttattgtggaaaatggattagttaaagga
acttggggaaatgtttcaattagggataaagattatgtttatataacgccatcaggtata
ccgtatgataagttgaaagaagaaatgataagtgttgttgattttaatgggcgtttgatt
gatggtttgaaaccttcctcagaacttccgacgcatttggaaatttataagaatcgcaaa
gatgttaatgcaatagtccatacgcatcctgtgttttcgaccactgtttcagtagtatca
agtgaaatacccccattgatagaagatgcagttatgattttaggaccagaaattaaagtt
tcagaatacgctcttcctggaagtattgaacttgcaaaaaatgttgtagatgctctttct
gataacaatgcagttatattaaaaaaccacgggctaattacagtaggttttgatattgat
gaagcattgactgcaagcttagtttgtgaaaagacagctgaaatatatttatatactttg
aatattggaaatttttcgacaattagttatgaagacgcggttatactgagaaataagtat
ttaaacggttatagacagattaaaaaagatattggataa

DBGET integrated database retrieval system