KEGG   Thermosipho sp. 1070: Y592_01275Help
Entry
Y592_01275        CDS       T04909                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ther  Thermosipho sp. 1070
Pathway
ther00260  Glycine, serine and threonine metabolism
ther01100  Metabolic pathways
ther01110  Biosynthesis of secondary metabolites
ther01120  Microbial metabolism in diverse environments
ther01130  Biosynthesis of antibiotics
ther01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ther00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Y592_01275
Enzymes [BR:ther01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Y592_01275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Pyridoxal_deC Met_gamma_lyase OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ANQ53165
Position
complement(258170..259183)
Genome map
AA seq 337 aa AA seqDB search
MYIDLRSDTVTKPTEEMRKAMAYAEVGDDVYMDDPTVNKLEKLCADILGKEASLFVPSGT
FANQLALFTHCQRGDEVIIGDNYHIVQHEAGAAAVIAGVQLRTVETKKGAMIPEVLESKI
RKVEDIHYPRTGLICLENAHSNGNVIPLDNFKKIREIAGNIPIHLDGARLFNASTFLKVE
PKEIAKYADSINICLSKGLCAPVGSLLVGNKEFIERARKKRKIMGGGMRQVGILAAAGIV
ALEKMRFRLEEDHENARYLAKRLSNFAFIEIVEKVEINMVFFKIDKNFSTNEFIEYLLKN
NIKINPPEDGVFRFVTHYWIKREDIDYVVETMAKFFN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtacatagatttaagaagtgatacagtaacaaaacctacagaagagatgagaaaggca
atggcatacgcagaagttggagatgatgtatatatggatgatccaacggtaaacaagctt
gaaaagttatgtgcagatatattgggaaaagaagcttccttgtttgttccaagtggtact
tttgcaaatcaacttgctttgtttacccattgtcaaagaggagatgaggttattatcggt
gacaactatcatatagtccagcatgaagcaggtgctgctgctgtaattgcaggtgtgcag
ctaagaacagttgagacaaaaaaaggtgcgatgattcctgaagttttagagagtaagata
aggaaagttgaagatatacactatcccagaacaggattgatttgtcttgaaaatgcccat
tcaaatgggaatgtaatacctttggataactttaaaaaaataagagaaatagcaggaaat
attcctattcatctagatggagcaagattgtttaatgcgtcaacctttctaaaggtggaa
ccaaaagaaattgcaaaatatgctgattctataaatatctgtctttcaaaagggttatgt
gcacctgttggttcacttttggttggaaacaaggagtttattgaaagggcgagaaaaaag
cgtaaaataatgggcggtggtatgcggcaagtgggaatattagctgcggcgggcattgtt
gcattagaaaaaatgcgttttagattggaagaagatcatgaaaatgcaagatatttggca
aaaaggttgagtaattttgcctttatagaaattgtcgaaaaggttgaaataaacatggta
tttttcaagatcgataagaatttttccacaaatgaatttattgagtatcttttaaaaaac
aacataaaaataaatccgccagaggacggagtgtttaggtttgttacacattattggata
aaaagagaggatattgattatgttgtagaaaccatggcaaagtttttcaattaa

DBGET integrated database retrieval system