KEGG   Thermosipho sp. 1070: Y592_05360
Entry
Y592_05360        CDS       T04909                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
ther  Thermosipho sp. 1070
Pathway
ther00472  D-Arginine and D-ornithine metabolism
ther01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ther00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Y592_05360
Enzymes [BR:ther01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Y592_05360
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: ANQ53839
Position
1065798..1066172
AA seq 124 aa
MKPRKDDFKERSKHLQKMTEEELNQYFWHLVEKVVDPLIELAETHTSPSVERSVLLRMGF
NSLEASKIVDLVFQRNLLGKGAGHIVWRIAKEKNMDILDAGRALIEGKYWEDVDRIFKGV
NNDA
NT seq 375 nt   +upstreamnt  +downstreamnt
ttgaagcctagaaaagatgattttaaagaaagaagtaaacatttacaaaagatgaccgaa
gaagaacttaatcagtacttttggcatcttgttgaaaaagttgttgatcctctaatagag
cttgcagaaacacatacttctccttctgtggaaagatcagtacttcttagaatgggattt
aatagtttggaagcttcaaaaattgtagatttagtttttcagagaaatttgttgggaaag
ggcgcaggtcacattgtttggagaatagctaaagagaaaaatatggatattttagatgca
ggaagggcacttatagaagggaagtattgggaagatgtggataggatatttaaaggggtg
aataatgatgcttga

DBGET integrated database retrieval system