KEGG   Thermosipho sp. 1070: Y592_05365
Entry
Y592_05365        CDS       T04909                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
ther  Thermosipho sp. 1070
Pathway
ther00472  D-Arginine and D-ornithine metabolism
ther01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ther00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Y592_05365
Enzymes [BR:ther01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Y592_05365
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ANQ53840
Position
1066162..1068357
AA seq 731 aa
MMLDPKKPIDIDEILKDLDKYRPKRKGWVWRKRLPEGTKIGDYKYYQVSEDLKNSIPLPA
AHYFGSIDPQPEVVITSEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHYDGLIEGT
PEGIGGIPITRKQLRATRKALDLIEEEVGRPINFHSYVSGVAGPEIAVLFAEEGVNGAHQ
DPQYNVLYRGINPIRSFVDAAVAKKIMASVNMLQIDGAHNANASAKLAWTVMPELLVQHG
INCMYSLKAGMKKEYIALSTVPPVVAPMPEFRYNLPYAVALRELFDGFKFRAQMNTRYIE
SDLFDATRIHVLNTLISRLTSADLQSTITPDEGRNVPWHVNSIRGVETAKHTLVALDGMK
QYVKIDEKKIRERVRELKMRAILMLEEILDMGGYFEALEAGMFVDNGYYPERIGDGIARK
KDGEIAAGTVVPREADYMAPVCEHFGYNNLPKDIEKPCDLIGGCTLHNPDKIQFIDELDE
SDNVNVRLEKIRDMRKRKVIKPEVEWFSDGWIQMDMTFALPKELAEAAAIALCEKLGLEE
PTIIHKTILHPSEGTYIEVKAKVPFEIEIDKLELPKKPETLPEEEIFEYVKNNPIHVVAG
TVGNDEHSVGLREILDIKHGGIEKYGIKYTYLGTSVPPEKLIDAAIETGAKAILASMIIT
HNDVHVQNMKKIHELAIEKGIRNKVIIIAGGTQINNDLAIENGMDAGFGRGTKGIHVASF
IVKKLKEKESK
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgatgcttgatccaaaaaaacctatagatatagatgaaatattgaaagatttggataaa
tataggccaaagagaaaagggtgggtgtggagaaaaagacttcctgaaggtacgaaaata
ggagattacaagtactaccaagttagcgaagacttgaaaaattctattcctcttcccgct
gcacactattttggaagtatagatccacaacctgaggttgtaattacttcggaaattgcc
tctggaaggtttgaagatgatatcagaagaatgagaatggccgcttggcatggagcagac
catattatggttataaggactttgggacaatcgcattacgatggacttattgaaggtaca
ccagaaggtataggtggtattcccattacaagaaaacaacttagagctacaagaaaagcc
ttagatttgatagaagaagaggtaggaagacctataaactttcacagttatgtgtcgggg
gttgctggacctgaaattgccgttttgtttgcagaagaaggggtaaatggagcgcaccag
gatcctcaatataatgttttgtataggggaattaaccctattcgttcatttgtagatgct
gccgttgcaaagaaaattatggcttctgttaacatgttacagattgacggtgcacacaat
gccaatgcctctgcaaagcttgcatggacagttatgcctgaacttttagtacagcatgga
attaattgtatgtattctttaaaagcaggaatgaagaaagaatatattgcactttctaca
gtaccacctgttgtagcaccaatgcccgagtttaggtataaccttccttatgcagtggct
ttaagagaattatttgatggatttaaatttagagctcaaatgaatacaagatatatagaa
tccgatttatttgatgcgacaaggatacatgtgcttaatacattgatttcaagactaacc
tctgctgatctacaatcaactattactccagatgaaggtagaaatgtgccgtggcatgta
aactcaatacgtggagtagaaacggcaaagcacaccttagtagcattagatggaatgaag
cagtatgtgaaaatagacgaaaagaaaattagggaaagggtcagagaacttaaaatgcgt
gcaattttaatgcttgaagaaatattggatatgggaggatatttcgaagcgttagaagca
gggatgtttgttgataatggatattatccagagagaataggagatggaattgcaaggaag
aaagatggcgagatagctgcaggtacagtagtaccaagagaagcagattacatggcgcca
gtttgcgagcattttggttacaacaatttaccaaaagatatagaaaagccatgtgattta
attggtggatgtactttacataatccagataaaatacaatttatagacgaattagatgaa
agtgataatgttaatgttagacttgagaagataagggatatgaggaaaagaaaggttatt
aaacctgaggttgagtggttttcagatggttggatccaaatggatatgacatttgcacta
cctaaagaacttgcagaagctgctgctatagcgttgtgtgaaaaattagggcttgaggaa
ccaacgattattcataagacaatattacatccatctgaaggaacatatattgaagtgaaa
gcaaaggtgccatttgaaattgaaattgataaattggaacttccaaaaaaacctgaaact
ttgcctgaagaagagatattcgaatatgtaaagaacaatcctatacacgtagttgccggt
acagtggggaatgatgagcattctgttggattaagggaaatattggatattaaacatgga
ggaattgaaaagtatggtataaaatatacgtatcttgggacaagtgttccacccgaaaag
ctcatagatgcagctattgagactggagcaaaggcaatacttgcatctatgattataacc
cacaatgatgtgcacgtacaaaatatgaagaaaatccacgaattagctattgaaaaaggt
ataaggaataaggttataattattgcaggtgggacacaaattaacaatgatttggcaatt
gaaaatggtatggatgcaggatttggtcggggaacaaaaggaatacatgttgcttcattt
atagtaaaaaaattaaaggagaaagaatctaaataa

DBGET integrated database retrieval system