KEGG   Thermofilum uzonense: MA03_00910Help
Entry
MA03_00910        CDS       T03924                                 

Definition
(GenBank) hypothetical protein
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
thf  Thermofilum uzonense
Pathway
thf00051  Fructose and mannose metabolism
thf00520  Amino sugar and nucleotide sugar metabolism
thf01100  Metabolic pathways
thf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MA03_00910
   00520 Amino sugar and nucleotide sugar metabolism
    MA03_00910
Enzymes [BR:thf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     MA03_00910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AKG38140
UniProt: A0A0F7FH28
Position
complement(167153..167914)
Genome map
AA seq 253 aa AA seqDB search
MGELGNTVGVILCGGEGKRLRPLTYYFQKAMIPIGTQQKPLLEYIVRLMKYHGIRDIVML
VGYKGQQIVNYFNKGERYGVSISYVWDDPNYGGNGGALYNAYLKGVLDNAENVLIYYGDI
LSDINLADMIKFHEEKNFTSTLALSPNYRVAVGVAELEGDRVTKLVEKPFLGKPVTIGVL
VVRRRALDYLSEIAENKKDIDIMGDLIGMFLQRNLRVGGYITSSFWFDLGTTEAYEKLEP
AEVDQRFSFLFQE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaactaggaaataccgttggtgtcattctttgcgggggtgagggaaaaaggctg
cgacctttaacctattactttcagaaagctatgatacctataggcacgcagcaaaaaccg
ctcttagaatacattgtacgtttgatgaagtatcatgggattagagacattgtaatgctt
gtggggtacaaaggtcaacaaatagtcaattacttcaataaaggagagagatatggtgta
agcatttcttatgtgtgggatgaccctaactatggaggtaacggtggagccctctataat
gcttacttgaagggcgtcttagataacgcggagaacgttctaatatattatggagatatt
ctctcggacattaatctcgctgatatgatcaagttccatgaggagaaaaacttcacttca
acgcttgcattgtctccaaattatcgtgttgctgtcggagtagccgagctcgaaggagac
agagtgacaaaacttgtcgaaaagccattcctcggcaagccggtaacaataggagtgcta
gtcgtaaggaggcgtgcgctggactatctgagtgagatagctgagaacaaaaaggatatt
gacattatgggcgacttaataggaatgttccttcaacggaatttacgagtaggaggctat
ataacttctagcttttggttcgacttagggactactgaagcttatgagaagctcgaaccc
gcagaggtcgatcaaaggtttagcttcttgttccaagagtaa

DBGET integrated database retrieval system