KEGG   Thermogladius calderae: TCELL_0263Help
Entry
TCELL_0263        CDS       T02127                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
thg  Thermogladius calderae
Pathway
thg00010  Glycolysis / Gluconeogenesis
thg00051  Fructose and mannose metabolism
thg00562  Inositol phosphate metabolism
thg01100  Metabolic pathways
thg01110  Biosynthesis of secondary metabolites
thg01120  Microbial metabolism in diverse environments
thg01130  Biosynthesis of antibiotics
thg01200  Carbon metabolism
thg01230  Biosynthesis of amino acids
Module
thg_M00002  Glycolysis, core module involving three-carbon compounds
thg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCELL_0263
   00051 Fructose and mannose metabolism
    TCELL_0263
   00562 Inositol phosphate metabolism
    TCELL_0263
Enzymes [BR:thg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TCELL_0263
Exosome [BR:thg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TCELL_0263
  Exosomal proteins of bladder cancer cells
   TCELL_0263
  Exosomal proteins of melanoma cells
   TCELL_0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS DHO_dh Trp_syntA NMO FMN_dh His_biosynth CutC
Motif
Other DBs
NCBI-ProteinID: AFK50688
UniProt: I3TD50
Position
complement(255266..255877)
Genome map
AA seq 203 aa AA seqDB search
MKELGGGVEIVLAPPYTEIRRVVEEVTGSGVRVFAQHADPVEPGAVTGFMPLEGLKEAGV
SGVILNHSEHRLKLADINSLVKKAAKLGLETLVCADEPETGAAVAALEPNYVAVEPPELI
GTGISVSKAKPEVIIRSVELIRRVNSRVVILTGAGITDGQDVYSAIRYGTSGVLVASAIV
KAKDPYSVIRDMAVSALKAVTGQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaactgggcggtggagtcgagatcgttctggccccgccctacactgaaatacgg
agggtcgtcgaagaggtaacagggtctggtgttagggtcttcgcacaacacgccgacccc
gtggagcctggagctgttacgggtttcatgccgctcgagggtctcaaagaggcgggtgtg
agcggagtcatacttaaccacagcgagcacaggctcaaacttgcggacatcaactcactg
gtcaagaaggccgctaagctcgggctggagacgcttgtctgcgccgacgagcccgagacg
ggcgctgccgtggccgctctcgaacccaactacgtcgctgtcgagccacctgagcttata
ggcacgggtattagtgtgagtaaggctaaaccagaagtcattattaggagtgttgaactc
atcaggagagtcaatagtagagtagtgatcttgacgggcgccggcataacggacgggcaa
gacgtgtactcggctataaggtacgggacgagcggcgttctagtcgcgtcggcgatcgtg
aaggcgaaagacccctactcagttataagggacatggctgtaagcgctcttaaagccgtc
accggccagtag

DBGET integrated database retrieval system