KEGG   Thermogladius calderae: TCELL_0566Help
Entry
TCELL_0566        CDS       T02127                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
thg  Thermogladius calderae
Brite
Enzymes [BR:thg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TCELL_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_24 GCD14 Methyltransf_25 Methyltransf_11 Methyltransf_3 RrnaAD Methyltransf_18 MTS Methyltransf_32 Methyltransf_23 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: AFK50991
UniProt: I3TE03
Position
complement(513732..514418)
Genome map
AA seq 228 aa AA seqDB search
MSEDNMFRVSRERVIEMLEREGYLKSGIVKRALLSVPREMFVPENLRKYAYYDTPLPIGY
GQTISAIHMVAIMTEALDPLPGMKVLEVGTGSGYQAAVLAEIVAKMDPSHRGHVYTVERV
PELAEFAKRNLERAGYKDYVTVVVGDGSKGYPEGAPYDRIIVTAGAPSVPKPLIDQLDVH
GKLVIPVGDRFIQRLLIVEKKASGELSMKWGIDCVFVPLIGEYGWREE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgaggacaacatgttcagagtcagcagggagagagtaatagaaatgctggagaga
gaggggtacttgaagagcggtatcgtgaagagggctctgttatcggttccacgcgagatg
ttcgttccggagaacctgaggaagtacgcttactacgacacaccgcttccaataggctac
gggcagaccattagcgctatacacatggtggccatcatgacagaggccttggatccacta
ccggggatgaaagtactggaggtcggtaccgggtctggctaccaagccgcagtcctggcc
gagatcgtggccaaaatggacccgagccacaggggacacgtctacacggtcgagagggta
ccagagctcgccgagttcgctaagcgtaacctcgagagagcggggtacaaggactacgtg
acagttgttgtgggcgacggttctaagggttacccagagggggcaccctacgacagaatt
atagtgacagccggcgctcccagcgtacccaagcctctcatagaccagctagacgtacac
ggcaaactcgttatacctgtcggcgatagattcatacaaagactcttgatcgtcgagaag
aaggctagtggagagctgtccatgaagtgggggattgactgcgtcttcgtccccttgatc
ggagagtacgggtggcgagaggagtga

DBGET integrated database retrieval system