KEGG   Thermogladius calderae: TCELL_0889Help
Entry
TCELL_0889        CDS       T02127                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
thg  Thermogladius calderae
Pathway
thg00300  Lysine biosynthesis
thg01100  Metabolic pathways
thg01120  Microbial metabolism in diverse environments
thg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TCELL_0889
Enzymes [BR:thg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TCELL_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFK51313
UniProt: I3TEX5
Position
822710..823846
Genome map
AA seq 378 aa AA seqDB search
MVDYYREVLSSHGVHVTVHRVDDDYVRKHLPREYNPDKPRYILLARVGSGERVLQFNGHY
DVVAAGEGWETPPFQPVVKDGLVYGRGATDMKGGIASVVGALAYVASGKEPEIVVEAALV
PDEEIGGLTGTGYLVNVLGSRPDWVVIAEPSGIDNIYIGHRGGVWAMVKVYGVQAHGSTP
WLGDNAFEKMVYLAKLFIEEYKPSLAQRRSRFEYEMPEASNPTLTLGGKLVAPGSINIVP
GIVGFSVDRRLIVEERADEVVEELRRFLENASARLGVRAELEVMEKSDPALTDPGSHLVR
VLEDSITGTLNLKPRKTICVGGLDLRYYAAKNIQAVAYGPGEVGMAHKVNEYVKLADIVK
VAETYVDLVYRLSPGTSR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggtcgactactacagggaggtgcttagtagccacggcgttcacgtaacggttcacaga
gtcgacgacgactacgtcaggaagcacctgccgcgagagtacaaccccgacaagcctaga
tacatactcctagcccgcgtcggcagcggtgagagagtcctccagttcaacgggcactac
gacgtggtagcggccggggagggctgggagacaccccccttccagcccgttgtaaaggac
ggccttgtctacggtagaggggcaacggacatgaagggcggcatagcctccgttgtaggc
gcgctcgcttacgtggcctctggaaaagagccggagatagtcgtcgaggcggccctcgta
cccgacgaggaaataggggggttgacaggcaccggctacctggtcaacgttctgggtagt
aggcctgactgggtggtgatagcggagcccagcggtatcgacaacatctatatcggtcac
agaggcggtgtctgggcgatggttaaggtctacggggttcaggctcacggctcgactccc
tggctaggtgacaacgccttcgagaagatggtttacctggccaagctgttcatagaggag
tacaagcctagcctggcgcaacgtaggagcagattcgagtacgagatgccggaggcctca
aatcctaccctgacgttgggcggtaagctggtggccccagggtcaataaacatcgtgccc
ggtattgtcgggttcagtgtagacaggaggttgatcgtagaggagagagcagacgaagta
gtcgaagaactgaggaggttccttgaaaacgcctctgcgaggctcggagtgagggcggag
ctcgaggtgatggagaagtcggaccccgccctgacagaccctggctcccacctcgtgaga
gtcctcgaggactccatcactggaaccctcaaccttaagccgaggaagacgatttgtgtt
ggcggcttagacctacgctactacgcggcgaagaacatacaggcggtagcctacggccca
ggagaggtcgggatggcccacaaggtcaacgagtacgtcaagctcgcggacatcgtcaag
gttgccgagacctacgtggatctggtctacaggctttcccccgggacaagtagataa

DBGET integrated database retrieval system