KEGG   Thermogladius calderae: TCELL_0939Help
Entry
TCELL_0939        CDS       T02127                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
thg  Thermogladius calderae
Pathway
thg00790  Folate biosynthesis
thg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TCELL_0939
Enzymes [BR:thg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TCELL_0939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF1611_N
Motif
Other DBs
NCBI-ProteinID: AFK51363
UniProt: I3TF25
Position
876663..877535
Genome map
AA seq 290 aa AA seqDB search
MPQIDAVIAGVRVGDNSPVRLMGVVNVSPESFYKGSVKADAGELIRTVEAFLRSNTDFLD
IGGRSTAPYLKTDVPLEVELERVVWAVKLVRDVFGDKVPISIDTTRSRVAEEALRAGANI
VNDVSGLREDPRMAVVAREYGAPLILVARVSSYRSGVSPIDQVIGAVKESLSRAVESGVD
EKLIVVDPGIGFNRFQDLPWYVWDSMVLAELEKLRGLGRPILVGVSRKSFIGEITGRKDP
AERLYGSLGATAIAVYNGAHIVRTHDPAETLDVVKVASFIRLYKTRQMSW
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcagatcgacgctgtgatagccggtgtgagggtcggcgacaacagccctgtcagg
ctcatgggcgtcgtcaacgtgtccccggagtccttctacaagggtagcgtgaaagcggat
gcgggggagctcattagaaccgtcgaggcgttcttgaggagcaacaccgacttcctggac
atcggtgggaggtctacggcgccctacctcaagacagacgtgccactcgaggtagagctg
gagagagtcgtctgggctgtgaaactagtcagagacgtgttcggcgacaaggtcccgata
tcgatcgacaccaccaggtctagggtcgcagaggaggctcttcgggccggggcaaacata
gtaaacgacgtctcgggattacgcgaggaccctagaatggccgtagtggcgagggagtac
ggtgccccgttgatcctcgttgccagggtgtcctcgtataggagcggcgtcagcccgatc
gaccaggtcatcggggcggttaaagagtccctatcgagggccgtggagagcggtgtcgac
gagaagctcatcgtagtagaccccggtatagggttcaacaggttccaggatctaccgtgg
tacgtgtgggactccatggtcctagccgagctagagaagctgagggggctagggcggccc
atcctggtcggcgtgtctaggaagtcgttcataggagagatcacgggccgtaaagaccct
gctgagaggctgtacggcagccttggcgcgaccgcgatcgccgtctacaacggggcacac
atagtgaggacccacgacccggcggagacacttgacgttgtcaaggtagcgtccttcatc
aggctctacaagacccggcagatgtcctggtag

DBGET integrated database retrieval system