KEGG   Thermogladius calderae: TCELL_1235Help
Entry
TCELL_1235        CDS       T02127                                 

Definition
(GenBank) pyruvate ferredoxinoxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
thg  Thermogladius calderae
Pathway
thg00010  Glycolysis / Gluconeogenesis
thg00020  Citrate cycle (TCA cycle)
thg00620  Pyruvate metabolism
thg00640  Propanoate metabolism
thg00650  Butanoate metabolism
thg00680  Methane metabolism
thg00720  Carbon fixation pathways in prokaryotes
thg01100  Metabolic pathways
thg01120  Microbial metabolism in diverse environments
thg01130  Biosynthesis of antibiotics
thg01200  Carbon metabolism
Module
thg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCELL_1235
   00020 Citrate cycle (TCA cycle)
    TCELL_1235
   00620 Pyruvate metabolism
    TCELL_1235
   00640 Propanoate metabolism
    TCELL_1235
   00650 Butanoate metabolism
    TCELL_1235
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TCELL_1235
   00680 Methane metabolism
    TCELL_1235
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TCELL_1235
Enzymes [BR:thg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TCELL_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_7 Fer4_9 Fer4_10 Fer4_16 Fer4_2 Fer4_17 Fer4_13 Fer4_4 Fer4_15 Fer4_8
Motif
Other DBs
NCBI-ProteinID: AFK51658
UniProt: I3TFX0
Position
1176700..1176972
Genome map
AA seq 90 aa AA seqDB search
MSQQAGWRSLPKAGVTFRLSTDYKTGDWRALKPVIDYNKCTKCMLCWLFCPDMAIVWDGE
NVVVNYDYCKGCGICANECPVKAISMVPEF
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcaagccggttggagaagcctccctaaagcaggtgtgaccttcaggctgtca
accgactacaagactggggactggagagccctcaagccggttatagactacaacaagtgc
acgaagtgcatgctctgctggttgttctgccccgacatggcgatagtctgggacggtgag
aacgtggtggtgaactacgactactgtaagggctgcggtatctgcgcaaacgagtgcccg
gttaaggccataagcatggtacccgagttctag

DBGET integrated database retrieval system