KEGG   Thiomonas arsenitoxydans: THI_0876Help
Entry
THI_0876          CDS       T02347                                 

Gene name
isoJ
Definition
(GenBank) Glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
thi  Thiomonas arsenitoxydans
Brite
Enzymes [BR:thi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     THI_0876 (isoJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: CAZ87581
UniProt: D6CS53
Position
complement(875947..876639)
Genome map
AA seq 230 aa AA seqDB search
MIDLYSWATPNGHKIHILLEELGLPYRVHGVNIGRGEQFAPDFLAISPNNKIPALIDSDG
PDGQPISVFESGAILLYLAEKTGRFLGTGPRARIATLEWLMWQMGSIGPMLGQAHHFRQY
APEKIDYAIARYTNEAHRLYGVLDRRLASQPYLAGDDYTIADIAVFPWCRSAANQGIDWA
EFAHAKRWFDTIAARPAVQRGVQVLTDVRPAEMDATAREQLFGSTQYQRR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctctactcctgggccacccccaacggccacaaaatccacatcctgctcgaa
gaactcggcctgccctaccgggtgcacggcgtgaacatcggccgcggcgaacagttcgcg
cccgactttctcgccatcagcccgaacaacaagattcccgccctgatcgatagcgacggc
ccggatggtcagcccatcagcgtgttcgagtcgggcgccatcctcctctatctggccgag
aagaccggccgctttctgggcacagggccgcgggcgcgcatcgccacgctcgaatggttg
atgtggcagatgggcagcatcggccccatgctcggccaggcgcaccacttccgccagtac
gcccccgagaaaatcgactacgccatcgcccgctataccaacgaggcgcaccggctctat
ggcgtgctcgaccggcggctggcgtcgcagccctatctggccggtgacgactacaccatc
gccgacatcgccgtctttccgtggtgtcgcagcgccgccaatcagggcatagactgggcc
gagtttgcgcatgccaagcgctggttcgacaccatcgccgcgcggcccgcggtgcagcgc
ggggtgcaagtgctgaccgacgtgcgcccggccgagatggacgccaccgcgcgcgaacag
ttgttcggcagcacccaataccagcgccgctga

DBGET integrated database retrieval system