KEGG   Thiomonas arsenitoxydans: THI_1747Help
Entry
THI_1747          CDS       T02347                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00630  Glyoxylate and dicarboxylate metabolism
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01200  Carbon metabolism
Module
thi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    THI_1747 (aceA)
Enzymes [BR:thi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     THI_1747 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAZ88419
UniProt: D6CT00
Position
1730229..1731536
Genome map
AA seq 435 aa AA seqDB search
MADRKQQVAALEQDWAQNSRWKGIKRGYGAEEVVRLRGSVMVEHTLARRGADRLWKQMHD
MPFVNALGALTGNQAMQQVKAGLQAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPSVVK
RINNTLTRADQIQWMEGKQPGDEGFIDYFAPIVADAEAGFGGVLNAFELMKSMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTREAVAKLVAARLAADVMGVPTVLVARTDAEAADLIT
SDVDDTDKPFCTGERTVEGFYRTKPGLEQAISRGLAYAPYADLVWCETGKPDLAYAKAFA
EAIHAKFPGKMLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSM
FNLAYGYARNQMSAFVELQEAEFAAAPKGFTAVKHQREVGTGYFDAVTTTIENEASTAAL
KGSTEDEQFFDRKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcgcaaacagcaagtggcagcgttggaacaggactgggcgcagaactcgcgc
tggaagggcatcaagcgcggttatggcgcagaggaagtggtgcgcctgcgcggttcggtg
atggttgagcatacgctggcccgtcgcggtgcggatcgtctttggaagcagatgcacgac
atgccgttcgtcaacgccctgggcgccttgactggcaaccaggccatgcagcaggtcaag
gccggcctgcaggccatctacctgtcgggctggcaagtggcgggtgatgccaacctggct
ggcgagatgtatcccgaccagtcgctgtatccggccaactcggtgcccagcgtggtcaag
cgcatcaacaacaccctcacccgagccgatcagattcagtggatggaaggcaagcagccc
ggtgacgaaggcttcatcgactatttcgcccccatcgtggccgatgccgaagccggtttc
ggcggcgtgctcaacgccttcgagctgatgaagtccatgatcgaggccggcgccgccggc
gtgcacttcgaagaccagttggcctcggtgaagaaatgcggccacatgggcggcaaggtg
ctggtgccgactcgcgaggctgttgccaagctcgtggcagcgcgcctggcggccgacgtc
atgggcgtgccgacggtgctggtggcgcgcaccgacgccgaagcggccgacctgatcact
tccgacgttgacgataccgacaagcccttctgcactggcgagcgcacggtcgaaggcttc
taccgcaccaagcccggcctggagcaggccatctcccgcggtctggcctacgcgccctat
gccgatctggtgtggtgcgaaaccggcaagcccgacctcgcctacgccaaggccttcgct
gaagccattcatgccaagttccccggcaagatgctggcctacaactgctcgccgtccttc
aactggaagaagaacctcgacgatgccaccatcgccaagttccagaaggaattgggcgcc
atgggctacaagttccagttcatcaccctggccggtttccacgcgctgaactattcgatg
ttcaacttggcctacggctatgcccgcaaccagatgagcgccttcgtcgagttgcaagag
gccgaattcgccgcagcgcccaagggcttcaccgcggtcaagcatcaacgcgaggtcggc
accggctatttcgacgccgtcaccacgacgatcgagaacgaggcttccaccgccgcgctc
aagggttcgaccgaagacgagcagttcttcgaccgcaaagtggcctga

DBGET integrated database retrieval system