KEGG   Thiomonas arsenitoxydans: THI_2041Help
Entry
THI_2041          CDS       T02347                                 

Gene name
cbbM
Definition
(GenBank) Ribulose bisphosphate carboxylase (RuBisCO)
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00630  Glyoxylate and dicarboxylate metabolism
thi00710  Carbon fixation in photosynthetic organisms
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01130  Biosynthesis of antibiotics
thi01200  Carbon metabolism
Module
thi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:thi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    THI_2041 (cbbM)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    THI_2041 (cbbM)
Enzymes [BR:thi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     THI_2041 (cbbM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CAZ88699
UniProt: D6CTT0
Position
complement(2001907..2003292)
Genome map
AA seq 461 aa AA seqDB search
MAHDQSSRYANLDLKESDLIAGGKHILVAYKMKPKAGYDYLATAAHFAAESSTGTNVEVS
TTDDFTKGVDALVYFIDEATEDMRIAYPIELFDRNVIDGRFMIVSFLTLVIGNNQGMGDV
EYGKMIDFYVPERAIQMFDGPATDISNLWRILGRPIKDGGYIAGTIIKPKLGLRPEPFAQ
AAYQFWLGGDFIKNDEPQGNQVFAPVKKVIPLVYDAMKRAQDETGEAKLFSMNITADDYH
EMCARADFALEVFGPDADKLAFLVDGYVGGPGMVTTARRQYPNQYLHYHRAGHGAITSPS
SKRGYTAFVLAKMSRLQGASGIHVGTMGYGKMEGEGDDRNIAYMIERDECQGPVYYQKWY
GMKPTTPIISGGMNALRLPGFFENLGHGNVINTAGGGSYGHIDSPAAGAKSLRQAYECWK
AGADPIEYAKEHIEFARAFESFPGDADKLFPGWRDKLGVHK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggctcacgatcaatccagccgctacgccaatctcgatctcaaggaatcggatctgatc
gccggtggcaagcacatccttgttgcctacaaaatgaagcccaaagcgggctatgactat
ctggcgacggcggcgcactttgcggccgaatcgtccaccggcaccaatgtggaagtcagc
acgacggacgatttcaccaagggggtcgatgccctggtttatttcatcgatgaagccacg
gaagacatgcgcatcgcctatccgatcgaactgttcgatcggaatgtgatcgacggccgc
ttcatgatcgtgtccttcctcacgctggtgatcggcaacaaccagggcatgggcgatgtc
gagtacggcaagatgatcgatttctatgtgcccgagcgcgcgatccagatgttcgacggc
ccggccaccgacatctccaacctgtggcgcattctgggtcggccgatcaaggacggcggc
tatatcgccggcaccatcatcaagcccaagttgggtctgcgcccggagccatttgcccag
gcggcctatcagttctggctggggggcgatttcatcaagaacgacgagccgcagggcaat
caggtattcgccccggtgaaaaaggtgattccgctggtctacgacgccatgaaacgcgcg
caagacgagactggcgaggccaagctgttctccatgaacatcaccgcggacgactatcac
gagatgtgcgcccgcgcggacttcgcgctggaagtcttcggtcccgatgctgacaagctg
gccttcctggtggacggctacgtgggcggccccggcatggtcaccaccgcgcgtcgccag
tatccgaaccagtacttgcactatcaccgtgcgggtcacggcgccatcacctcgcccagt
tccaagcgcggctacaccgcctttgtgctggccaagatgagccgcctgcaaggcgcctcc
ggcatccacgtcggcaccatgggttacggcaagatggaaggcgagggcgacgaccgcaac
atcgcctacatgatcgagcgcgacgagtgccaaggcccggtctattatcaaaagtggtac
ggcatgaagcccaccacccccatcatttccggcggcatgaacgcgctgcgcctgcccggc
ttcttcgagaacctgggccacggcaacgtgatcaacaccgcgggcggcggctcctacggc
catatcgactcgccggcagctggcgccaagtcgctgcgccaggcctatgagtgctggaag
gccggagccgatccgatcgagtacgccaaggagcacatagagttcgcgcgcgcattcgaa
tccttcccgggcgatgccgacaagctcttcccgggctggcgcgacaaactgggcgtccac
aagtaa

DBGET integrated database retrieval system