KEGG   Thiomonas arsenitoxydans: THI_2141Help
Entry
THI_2141          CDS       T02347                                 

Gene name
pstA
Definition
(GenBank) Phosphate transport system permease protein pstA
  KO
K02038  phosphate transport system permease protein
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:thi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    THI_2141 (pstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:thi02000]
    THI_2141 (pstA)
Transporters [BR:thi02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    THI_2141 (pstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Vma12 NADH_B2
Motif
Other DBs
NCBI-ProteinID: CAZ88794
UniProt: D6CU25
Position
complement(2096022..2096870)
Genome map
AA seq 282 aa AA seqDB search
MMSLYTRRQLINKINMIIAVLMTAFGIFWVIWILWTTARYGSPALNLHLFTQDTPPPGAE
GGGLRNAFVGSFILLGIALVIGTPIGILAGTWLGEFAVKRKLGGVVRFLNDILLSAPSIV
VGLFAYAILVDPLGHFSAFSGGVALALILIPVVVRTTDEMLRLVPGSLREAAIALGTPYW
KMVTKITWKAASTGILTGVILGVARISGETAPLLFTALNNQYFSSDVWHPMANLPVVIFQ
FAMSPYANWQQMAWAGAFVAVVFILILSLGSRWLISRGGVKS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgctttacacacgccgccaattgatcaataaaatcaacatgattattgccgta
ttgatgacggcattcggaattttttgggtgatctggattctctggaccaccgcacggtat
ggttcgccagcactaaatcttcacctttttacgcaggatacgcctcctccgggcgcagaa
ggtggcggattgcgcaatgcctttgtcgggagtttcattcttctaggtattgctttagtg
atcggaacgcctatcggcattctggcgggaacttggctgggcgagtttgccgtcaagcgc
aagctcggtggggtagtgcgatttcttaatgacattctgctgagcgcaccctccatcgtc
gttggtttgttcgcttatgcaattttggtcgatccgttaggccatttctcggcgttttca
ggcggtgttgctctcgcactgattctgatcccggttgtggtgcgcacgacagatgaaatg
ttgcgtcttgtgcccggttcattacgtgaagcggccatagcccttggcacgccctattgg
aaaatggtgaccaagatcacctggaaggccgcctctaccggcattttgacgggtgtgatt
cttggggtagcgcgaatcagtggtgaaacggcacctctgctcttcacagcgctaaacaat
cagtactttagttcagatgtgtggcatccgatggcgaatttgcctgtagttatttttcag
tttgctatgagtccttatgcgaactggcaacaaatggcttgggctggtgcgtttgtggcg
gtggtgttcatcctgattctcagcctgggttcacggtggttgatcagccgcggcggtgtg
aaatcctga

DBGET integrated database retrieval system