KEGG   Thiomonas arsenitoxydans: THI_2516Help
Entry
THI_2516          CDS       T02347                                 

Gene name
arcA
Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00220  Arginine biosynthesis
thi00330  Arginine and proline metabolism
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01130  Biosynthesis of antibiotics
thi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    THI_2516 (arcA)
   00330 Arginine and proline metabolism
    THI_2516 (arcA)
Enzymes [BR:thi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     THI_2516 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CAZ89141
UniProt: D6CV22
Position
2480224..2481144
Genome map
AA seq 306 aa AA seqDB search
MSASPVIHLIGAPTDIGAADRGASMGPEALRVAGIDRALRAQGLTVLDTGNLIGPHNPWQ
PPACGYRHLPEVIAWNTAVHQAVGDALRAQALPILLGGDHCLAIGSLSAVAQHCRAQGRK
LRVLWLDAHADFNTHTVTPTGNLHGMPVACLCGKGPQALTTLGGPAPQLQPSCIRQIGIR
SVDAEEKRLVHQAGLDVFDMRYIDEYGMRDAMRRALEGVDADTHLHVSFDVDFLDPDIAP
GVGTTVPGGPTYREAQLCMEMIADTGLLASLDVVELNPAFDERNRTAEVAVDLIESLFGK
STLMRR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccagccccgtcattcatctcatcggcgcgcccaccgacatcggcgctgcagac
cgtggcgcctccatggggccggaagcgctgcgcgtggccggcatcgaccgcgccctgcgc
gctcagggcctgacggtgctcgataccggcaatctcatcggcccgcacaacccttggcag
ccgccggcctgcggctatcgccatctgcccgaagtcatcgcctggaacaccgcggtgcat
caggccgtgggcgatgccttgcgggctcaagccctacccatcctgctgggcggcgatcat
tgcctggccatcggctcgctcagcgcagtggcgcagcattgccgcgcacagggtcgcaag
ctgcgcgtgctgtggctcgacgcccatgccgacttcaacacccacaccgtcacgcccacc
ggcaacctccacggcatgccggtggcctgcctgtgcggcaaaggcccgcaagcgctcacc
accctgggcggcccggcgccgcaactgcaaccctcctgcatccggcagatcggcatccgc
agcgtggacgcagaggaaaaacggttggtgcatcaggccgggctcgacgtgttcgacatg
cgttacatcgacgaatacggcatgcgcgacgccatgcgccgggcactcgaaggcgtggac
gccgacactcatctgcatgtgagtttcgacgtcgatttcctcgaccccgacatcgccccc
ggcgtgggcaccaccgtgcccggcggccccacctaccgcgaggcgcagctttgcatggaa
atgatcgccgacaccggcctgctggcctcgctcgacgtggtggaactcaaccccgctttc
gacgaacgcaaccgcaccgccgaggtggcggtcgatctcatcgagagcctgttcggcaag
tccacgctgatgcgcaggtga

DBGET integrated database retrieval system