KEGG   Thiomonas arsenitoxydans: THI_2714Help
Entry
THI_2714          CDS       T02347                                 

Definition
(GenBank) putative Succinate dehydrogenase hydrophobic membrane anchor protein (sdhD)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00020  Citrate cycle (TCA cycle)
thi00190  Oxidative phosphorylation
thi00650  Butanoate metabolism
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01130  Biosynthesis of antibiotics
thi01200  Carbon metabolism
Module
thi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
thi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
thi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THI_2714
   00650 Butanoate metabolism
    THI_2714
  Energy metabolism
   00190 Oxidative phosphorylation
    THI_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C MitoNEET_N DUF1211
Motif
Other DBs
NCBI-ProteinID: CAZ89327
UniProt: D6CL99
Position
complement(2669160..2669525)
Genome map
AA seq 121 aa AA seqDB search
MAADKIGNKRLVVGAHYGLRDWMAQRVTAAVIAVFTLVLLVYFLAPGPLSFERWHDLFAQ
QWMKLLTFVTVLALIYHVWVGMRDIWMDYVKPVGVRLLLQIGTILWLLACAGWALQVLWR
A
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgacaagattggaaacaagcgcctggtcgtcggcgcgcactacggcctgcgc
gactggatggcgcagcgcgtcaccgccgccgtgatcgcggtgttcaccctggtgttgctg
gtgtattttctcgcgcccggcccgctgagcttcgagcgctggcacgatttgttcgcccag
cagtggatgaagctgctgaccttcgtgacggtgctggcgctgatctaccacgtctgggtg
ggcatgcgcgacatctggatggattacgtcaaaccggtcggcgtgcgactgctgctgcag
atcggcaccattttgtggctattggcttgcgcgggctgggccctgcaagtgttgtggaga
gcgtaa

DBGET integrated database retrieval system