KEGG   Thiomonas arsenitoxydans: THI_3278Help
Entry
THI_3278          CDS       T02347                                 

Gene name
phbA2
Definition
(GenBank) acetyl-CoA acetyltransferase (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00071  Fatty acid degradation
thi00072  Synthesis and degradation of ketone bodies
thi00280  Valine, leucine and isoleucine degradation
thi00310  Lysine degradation
thi00362  Benzoate degradation
thi00380  Tryptophan metabolism
thi00620  Pyruvate metabolism
thi00630  Glyoxylate and dicarboxylate metabolism
thi00640  Propanoate metabolism
thi00650  Butanoate metabolism
thi00900  Terpenoid backbone biosynthesis
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01130  Biosynthesis of antibiotics
thi01200  Carbon metabolism
thi01212  Fatty acid metabolism
thi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:thi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    THI_3278 (phbA2)
   00630 Glyoxylate and dicarboxylate metabolism
    THI_3278 (phbA2)
   00640 Propanoate metabolism
    THI_3278 (phbA2)
   00650 Butanoate metabolism
    THI_3278 (phbA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    THI_3278 (phbA2)
   00072 Synthesis and degradation of ketone bodies
    THI_3278 (phbA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    THI_3278 (phbA2)
   00310 Lysine degradation
    THI_3278 (phbA2)
   00380 Tryptophan metabolism
    THI_3278 (phbA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    THI_3278 (phbA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    THI_3278 (phbA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    THI_3278 (phbA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thi04147]
    THI_3278 (phbA2)
Enzymes [BR:thi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     THI_3278 (phbA2)
Exosome [BR:thi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   THI_3278 (phbA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAZ89874
UniProt: D6CMU6
Position
complement(3192776..3193954)
Genome map
AA seq 392 aa AA seqDB search
MTDPIVMVSAARTPIGGLLGDFAAVPAWELGATAIAAAVQRAGIAGDAVNEVLMGNCLMA
GQGQAPARQAALKAGLPQSAGAVTLSKMCGSGMRAMMFAHDMLAVGSADVMVAGGMESMT
NAPHLAFVRKGVKYGLTQFYDHMALDGLEDAYDRGKAMGVFAESCVSKYAFSREEMDAFA
IASTERSKKANEDGSFEWEMAPVTVAGRGGEVKIARDEQPFKAKLDKIPTLKPAFKKDGA
ITAATSSSISDGAAALVLMRQSTADKLGCAPIARIRAHAVHAQAPEWFTTAPVGAIQKVL
DKTGWKATDVDLWEVNEAFAAVTMAAMREYKLPHEIVNVHGGAVALGHPIGASGARIVVT
LLGALRQRGLKKGVAALCIGGGEATAMAVELL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcccatcgtgatggtttctgccgcgcgcacgcccatcggcggcctgctcggc
gactttgctgccgtacccgcctgggagctcggcgctaccgccatcgccgctgccgtgcaa
cgcgcgggcatcgcgggcgacgccgtgaatgaagtgctcatgggcaactgcctgatggcc
gggcagggccaggctcccgcgcgccaggccgcactcaaggccgggctgccgcaatcggcg
ggcgcggtcacgctgtccaaaatgtgcggctcgggcatgcgggcgatgatgttcgcccac
gacatgctcgctgtgggctccgccgatgtgatggtggccggcggcatggagagcatgacc
aacgcgccgcatctggccttcgtgcgcaagggcgtgaaatacggcctcacccagttttac
gatcacatggcgcttgacggtctggaagacgcctacgaccgcggcaaggccatgggcgtg
ttcgctgaaagctgcgtgagcaaatacgccttcagccgcgaggagatggacgcctttgcc
attgcctcgactgagcgcagcaaaaaagccaacgaagacggcagcttcgagtgggagatg
gcgcccgtcacggtggcgggtcggggcggcgaggtgaaaatcgcccgcgacgagcagccg
ttcaaggccaagctcgacaagattcctacgctcaagcccgcgttcaagaaagacggggcc
atcaccgccgccacctcgtcgagcatttccgacggcgctgccgcgctggtgctgatgcgc
cagtccaccgctgacaagctgggctgtgcgccgatcgctcgtattcgcgcccatgcggtg
catgcgcaggcgcccgagtggttcaccacggcgcccgtgggggccattcagaaggtgctc
gacaagaccggctggaaggcgaccgatgtggacctatgggaagtcaacgaagccttcgcc
gccgtcaccatggcggcgatgcgggaatacaagctgccgcatgagatcgtgaacgtgcac
ggcggcgcggtggcgctgggccaccccatcggcgcgtcgggcgcgcgcatcgtcgtgacc
ctgctgggcgcgctgcggcagcgcgggctcaagaagggcgtcgccgcgctgtgcatcggc
ggcggcgaggccacggcaatggcggttgaactgctctga

DBGET integrated database retrieval system