KEGG   Thiomonas arsenitoxydans: THI_3789Help
Entry
THI_3789          CDS       T02347                                 

Gene name
hemN
Definition
(GenBank) Oxygen-independent coproporphyrinogen III oxidase (Coproporphyrinogenase) (Coprogen oxidase)
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00860  Porphyrin and chlorophyll metabolism
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THI_3789 (hemN)
Enzymes [BR:thi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     THI_3789 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: CAZ90363
UniProt: D6CP85
Position
3700067..3701470
Genome map
AA seq 467 aa AA seqDB search
MMNQSLDFQPDLLQRFDISGPRYTSYPTADRMHSGFGARDYAEELRRRAQRPDEPVSLYF
HVPFCETLCYYCGCNKIPTKNHGRSTPYLDSVEQELRLIASILQARLPVTQLHWGGGTPT
FLNDEEAARLMAMTREHFDLQPGGEFSIEIDPRKVNEARVAHLAQLGFNRMSVGVQDFAP
EVQQAVNRIQSVEETRLVIDAARANGFSSISLDLIYGLPFQNLDSFARTLDQVIEISPDR
LSLYSYAHLPHIFKPQRRINAEDLPTAEVKLGLLGLAIRRLEEAGYVYIGMDHFAKPGDE
LARAQREGKLHRNFQGYSTQAELDLLAFGVSSISNVGNCYAQNAKTIDEYTEMLAFGKLP
TARGVHLTPEDHLRRTAIQRLMCDFQLDLAALADEFKVDAATTFALDLQRLKPLEDAGLV
VREGPQGLRVQVTPQGRLLVRIVAMQFDGYLHQPREQLLQPRYSRVI
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcaatctctcgacttccagcccgatctgctccagcgtttcgacatctccggc
ccgcgttacacctcctaccctaccgccgaccgcatgcattccggtttcggcgcgcgcgac
tacgccgaggaattgcgacgccgcgcccagcgtcccgacgagccggtgtcgctgtatttc
cacgtgccgttctgcgagaccctgtgctactactgcggctgcaacaagattcccaccaag
aatcacggccgctccacgccctatctcgacagcgtggaacaggagttgaggctgatcgcc
agcatcttgcaagcccgtctgcccgtcacccagcttcactggggcggcggcacgcccacc
ttcctgaatgacgaggaagccgcgcggctgatggccatgacgcgcgaacatttcgacctg
cagcccggcggcgaattctccatcgagatcgacccgcgcaaggtgaatgaggcgcgcgtg
gcgcatctcgcccaactcggtttcaaccgcatgagcgtgggcgtgcaggatttcgcgccg
gaggtacagcaggcggtcaatcgcatccagagcgtggaagaaacccggctggtgatcgac
gccgcccgtgccaacggttttagctccatcagcctcgacctgatctacggcctgcccttc
cagaacctcgattcgttcgcccgcaccctcgatcaggtgatcgagatctcgcccgaccgg
ctctcgctctacagctacgcgcatctgccgcacattttcaagccgcagcgccgcatcaac
gccgaagatctgcctacggccgaggtcaagctcggcctgctgggtctggccatccgccgg
ctggaagaagcgggttatgtctatatcggcatggatcactttgccaagccgggcgacgag
ctcgcccgcgcccagcgcgagggcaagctgcaccgcaatttccagggctactccacccag
gccgaactcgatctgctggcctttggcgtatccagcatttccaacgtcggcaactgctac
gcgcagaacgccaagaccatcgacgagtacaccgagatgctggctttcggcaagctgccc
acggcgcgcggggtgcatctcactcccgaagaccacctgcgtcgcaccgccattcagcgg
ctgatgtgcgatttccagctcgatctggccgcgctggccgacgaattcaaagtggacgcc
gccaccacctttgccctcgacctgcagcgcctcaagccgctggaagatgccgggttggtc
gtgcgcgaaggcccgcaaggtctgcgcgtccaggtcacgccgcaaggccgcctgctggtg
cgcatcgtcgccatgcagttcgatggctatttgcatcagccgcgcgagcaattgctgcag
ccccgctattcgcgggtgatctga

DBGET integrated database retrieval system