KEGG   Thiomicrorhabdus sp. G1: FE785_01295Help
Entry
FE785_01295       CDS       T05983                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
thig  Thiomicrorhabdus sp. G1
Pathway
thig00630  Glyoxylate and dicarboxylate metabolism
thig01100  Metabolic pathways
thig01110  Biosynthesis of secondary metabolites
thig01120  Microbial metabolism in diverse environments
thig01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FE785_01295
Enzymes [BR:thig01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     FE785_01295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: QCU89361
UniProt: A0A4P9K3X7
Position
312294..312638
Genome map
AA seq 114 aa AA seqDB search
MSMIQTEDYRTKYTLETFSFLPDLTADEIYAQIVYIINQGWTPALEHEAPESASAHYWGM
WKLPFFGMRDPNEVLAELDACRAAYPNHLIRLIGYDNYTQCQGHNFVVYRPRGM
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgattcaaacagaagactaccgtacaaagtatacgctagaaactttctcattc
cttccagacctaacagcggatgagatctatgcgcagatcgtatatatcatcaaccagggt
tggactccggctcttgagcacgaagcaccagaaagcgcttcagctcactactggggtatg
tggaagctaccattcttcggtatgcgtgatccaaacgaagtattggcagagctagatgct
tgtcgtgcagcgtacccaaatcacctaatccgtttgattggttacgataactatacacag
tgtcaagggcacaacttcgtggtttaccgtccaagaggcatgtaa

DBGET integrated database retrieval system