KEGG   Thiomicrorhabdus sp. G1: FE785_01850Help
Entry
FE785_01850       CDS       T05983                                 

Definition
(GenBank) form I ribulose bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
thig  Thiomicrorhabdus sp. G1
Pathway
thig00630  Glyoxylate and dicarboxylate metabolism
thig01100  Metabolic pathways
thig01110  Biosynthesis of secondary metabolites
thig01120  Microbial metabolism in diverse environments
thig01130  Biosynthesis of antibiotics
thig01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FE785_01850
Enzymes [BR:thig01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     FE785_01850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: QCU89464
UniProt: A0A4P9K4N6
Position
412585..414000
Genome map
AA seq 471 aa AA seqDB search
MASKTFDAGVQDYQLTYWTPDYVPLDTDLLACFKVIPQEGVPREEAAAAVAAESSTGTWT
TVWTDLLTDMEFYKGRCYRIEDVPGDKSAFYAFIAYPLDLFEEGSVVNVLTSLVGNVFGF
KAVRSLRLEDIRFPMAFIKTCMGPPSGIQVERDKLNKYGRPMLGCTIKPKLGLSAKNYGR
AVYECLRGGLDLTKDDENINSQPFQRWRDRFEFVAEAVDKATAETGERKGHYLNVTSGTV
EEMMKRAEFAKELGQPIIMHDFLTAGFTANTTLANWCRENGMLLHIHRAMHAVIDRNPHH
GIHFRVLAKCLRLSGGDHLHTGTVVGKLEGDRASTLGFVDQLREAFVPEDRSRGVFFDQD
WGSMAGVFAVASGGIHVWHMPALVNIFGDDSVLQFGGGTQGHPGGNAAGAAANRVALEAC
VKARNEGRDLEREGGDILRDAARHSNELAVALETWKEIKFEFDTVDKLDVQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggctagtaaaacttttgacgctggtgtacaagactaccagttgacttattggactcca
gattatgttccattagacacagacctattggcgtgtttcaaagttatcccacaagaaggt
gtaccacgtgaagaagcggctgctgcggtagctgctgagtcttcaacaggtacatggaca
acagtatggacagacctattgacagacatggaattctacaaaggtcgttgttaccgaatt
gaagacgttcctggtgacaagtcagcattctacgcgtttatcgcttacccactagaccta
ttcgaagaaggttcagtagtaaacgtactaacatcacttgttggtaacgtattcggcttt
aaagcggtacgttctcttcgtctagaagatatccgtttcccaatggcgttcatcaagaca
tgtatgggacctccatcaggtatccaggttgagcgtgacaagctaaacaagtacggtcgt
ccaatgctaggttgtacaatcaagcctaagctaggtctatctgctaagaactacggtcgt
gcggtatatgagtgtctacgtggtggtctagatttaactaaagatgatgaaaacatcaac
tcacagccgttccagcgctggcgtgatcgttttgagtttgtagcggaagcggtagataaa
gcgacagctgaaacaggtgagcgtaaaggtcactacctaaacgttacttctggtactgtt
gaagaaatgatgaagcgtgctgagttcgccaaagaactaggtcagccgatcatcatgcac
gacttcctaacagctggttttacagcgaacacaacactagcaaactggtgtcgtgaaaac
ggaatgcttctacacattcaccgtgcgatgcacgcggtaattgaccgtaacccacaccac
ggtatccacttccgcgtactagcgaagtgtctacgtttgtcaggtggtgaccacctacat
acaggtaccgttgtaggtaagctggaaggtgaccgtgcgtcaacgctaggtttcgtagat
cagttacgtgaagcattcgtaccagaagaccgttcacgcggtgtattcttcgaccaagac
tggggttcaatggcgggtgtattcgccgttgcttcaggtggtatccacgtatggcacatg
ccagcacttgtaaacatcttcggtgatgactcagttcttcagttcggtggtggtacacag
ggtcacccaggtggtaacgctgcgggtgctgcggctaaccgtgttgcgctagaagcgtgt
gttaaagcacgtaacgaaggacgtgacctagagcgcgaaggtggggatatcctacgtgat
gcagctcgtcactctaacgaactagccgtagctctagagacttggaaagagatcaagttc
gagttcgacacagttgataaattggacgttcagtaa

DBGET integrated database retrieval system