KEGG   Thiomicrorhabdus sp. G1: FE785_04775Help
Entry
FE785_04775       CDS       T05983                                 

Definition
(GenBank) geranyl transferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
thig  Thiomicrorhabdus sp. G1
Pathway
thig00900  Terpenoid backbone biosynthesis
thig01100  Metabolic pathways
thig01110  Biosynthesis of secondary metabolites
Module
thig_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:thig00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FE785_04775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:thig01006]
    FE785_04775
Enzymes [BR:thig01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     FE785_04775
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     FE785_04775
Prenyltransferases [BR:thig01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   FE785_04775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: QCU89993
UniProt: A0A4V1HHS0
Position
complement(1054489..1055376)
Genome map
AA seq 295 aa AA seqDB search
MQTQLSAYQMRINLVLERAISQFSERQIGDRHPLFDAIRYATMNNGKRVRPALAYAIADA
LQIELQYIDSAAAALELIHSYSLVHDDLPAMDDDDLRRGQPTCHIQFDEATAILVGDAQQ
SLAFQLVSEDETLDAEHKVEILHLLSATSGPLGMIGGQMLDLRAEEQPVDLQQLKTLHIL
KTARLIQCALLIGAIHHQDYATLKPALWQLGELIGLAFQVHDDIIDIESSTETLGKPQGS
DQLNDKSTYPKLMGLDKAKQYRDELLNEAKNLLSNSAFKHPFIADLIDYIGSRDH
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaacacaattaagcgcctatcaaatgcgtatcaatctggttctggaaagagccatc
agccaattctcagaacgccaaatcggtgaccgacacccgctgtttgatgcgattcgttac
gccaccatgaacaatggtaaacgtgtcagacccgctttggcttatgctattgccgacgct
ttacagattgaattgcaatacatcgatagtgccgccgccgctttggaactgattcatagc
tactctttggttcatgacgacttgccggcgatggatgacgatgatctgcgcagaggtcaa
ccaacctgccatattcagtttgacgaagccacggcgatattggttggtgatgcgcagcag
agcctggctttccaattggtcagcgaggatgaaacactcgatgcggaacacaaggttgaa
atcctgcatctactcagcgcgaccagtggccccttaggtatgattggcgggcagatgctc
gatcttcgtgccgaagaacagcctgttgatctgcagcagctgaaaacgctgcatattttg
aaaaccgcccgcctcatccagtgtgctttactgattggtgccattcatcatcaagattat
gcgaccctgaaaccggctttatggcagctcggcgagctgattggtctggcctttcaggta
cacgacgatattatcgacattgaatcaagcaccgaaacccttggcaaaccgcaaggcagc
gaccagctcaacgataaatcgacctatccaaaactgatgggcttagacaaggccaagcag
tatcgtgatgagctgcttaatgaagcgaaaaacttattgagcaacagcgctttcaaacat
ccatttattgccgatctgatcgactatatcggctcgcgcgatcattga

DBGET integrated database retrieval system