KEGG   Candidatus Thioglobus sp. NP1: CRN91_02220Help
Entry
CRN91_02220       CDS       T05818                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
thin  Candidatus Thioglobus sp. NP1
Brite
KEGG Orthology (KO) [BR:thin00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CRN91_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FeoB_C
Motif
Other DBs
NCBI-ProteinID: AXE61504
UniProt: A0A344W7W9
Position
433201..434484
Genome map
AA seq 427 aa AA seqDB search
MEIILQNTDILIMLAIGFGLFMAWGIGANDVANAMGTSVGSGAITFKQAVIIAVIFEFAG
AVLAGGEVTATVRKGILDAGAFTSNPELLVYGMLASLLAAATWLLIASSLGWPVSTTHSI
VGAIVGFGAVGIGVEAVSWGKVYAIIASWVISPLIAGTMAIIIFKSLQRLVIDTENPLEN
AKKYLPFYVFFVGFVLSLVTLLKGLKHVDSLKHLGKDLPTSMLIAVGVGILASIIAAIIL
RRIKTDPADDSDFSYANMEKLFGGLMVITACSMAFAHGSNDVANAIGPLAAVYSIVASGG
EIVSKSVLPSWILLVGGGGIVFGLATFGFRVMRTIGKNITELTPSRGFSAELAAATTVVF
ASYTGLPVSTTQVLVGAVLGVGIARGLASLNLRVINKIFLSWIITLPAGALMSILFFFAL
KGFFGSS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatcatcttacaaaacaccgatattcttattatgttggctattggctttggctta
tttatggcatggggtatcggggctaatgatgtagcaaacgcaatgggaacctcagttgga
tctggagctattacttttaaacaagctgtaattattgctgttatttttgaatttgctggc
gctgttttggctggtggtgaggttactgcaacagttcgaaagggaattttggatgctggt
gctttcacatctaacccagagttacttgtctacggtatgcttgcatcattattagcagct
gcaacatggcttcttatagcttcatcactgggttggccagtatccacaactcattcaatt
gttggagcaattgttggttttggtgcagttggtataggggtagaggctgtttcatggggt
aaggtatacgcaataattgcaagttgggtgatttcacctttaattgcaggcacaatggca
atcattatatttaaaagtcttcagcgccttgttatagatactgagaatcctctcgaaaac
gctaaaaaatatcttcctttttatgtgttttttgttggctttgttctctcattagtgaca
ttattaaaaggcctaaaacatgttgattcattaaagcatcttggtaaggatcttccaaca
agtatgttgattgcagttggtgttggaatattggcgtctattattgcagcaattattctt
agacgtattaaaacagatcctgcagacgatagtgatttctcatatgctaatatggaaaaa
ttatttggtgggttgatggttatcaccgcttgttcaatggcctttgcacatggttctaat
gacgttgcaaatgctattggccccttggctgctgtctatagtattgttgcatcgggaggt
gaaattgtttccaaaagcgtactaccctcttggattcttttagttggtggtggaggaatc
gtttttggacttgcaacctttggctttagagtaatgagaactataggtaaaaacattaca
gagctaacaccaagcaggggcttttctgctgaacttgctgccgcaacaactgttgtattt
gcctcttatacgggtcttccagtttcaacaactcaggttcttgttggagcagttttagga
gttggtattgcaagaggacttgcctcactaaacctaagggtcattaataaaatctttctt
tcatggattatcactttgccagctggagcattaatgtcgattttatttttctttgcactc
aagggcttctttggttcatcttaa

DBGET integrated database retrieval system