KEGG   Candidatus Thioglobus sp. NP1: CRN91_03620Help
Entry
CRN91_03620       CDS       T05818                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
thin  Candidatus Thioglobus sp. NP1
Pathway
thin00620  Pyruvate metabolism
thin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CRN91_03620 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:thin02000]
    CRN91_03620 (oadA)
Enzymes [BR:thin01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     CRN91_03620 (oadA)
Transporters [BR:thin02000]
 Other transporters
  Primary active transporters [TC:3]
   CRN91_03620 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 PTS_EIIA_1 F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: AXE61762
UniProt: A0A344W8M7
Position
701035..702837
Genome map
AA seq 600 aa AA seqDB search
MSNKENNQPVEVTELVLRDGHQSLFATRMRIDDMLPIAEKLDQIGYWSMESWGGATFDAC
IRFLGEDPWERIREIKKVMPNTPQQMLLRAQNLLGYRHYSDDVVRKFVDRCADNGVGVLR
IFDAMNDVRNLETAIDQTIKVDQHAQGTISYTVSPVHTIELWIEMAKRIEDMGAHSLCIK
DMAGLLQPYVAFELVKKLKKAIDIPIQLHAHATTGLSTASIIKAVEAGIDRVDTCIGSMS
MTYSHSATNSIVSILENSPRKTGLNLEKLEEIDQYFKPIRAKYSKFEGSLKGVDSRILTS
QVPGGMLTNMEGQLKEQNAIDKMDEVLLEIPRVRKDLGYIPLVTPTSQIVGTQAVLNVLT
GERYKTITKESSGILKGEYGASPAPLNKELQDRVLEGSKVITCRPADNLKPELEILEAEF
DKIVADKGIRVADEKVDDLMTYALFPQVGVQFLENRDNPDFFEPVPQEPREFNPNDNSEG
IYTVSFEGQSYTVNVTSGGDIASIGSSSAVTEVHNMVQKDAESDPSKFTAKEKVAAPLSG
TIWKVLVSPNQSINEGDTLLILEAMKMETEVKATRTGTVISVDVKEGDSVTVGQLLLSLR
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataaagaaaacaatcagcctgttgaagttactgagttagtattaagagatggt
catcaatctttattcgctactcgaatgagaattgatgacatgcttccaatagcagaaaaa
ctagatcagattggttactggtcaatggaatcctggggcggcgcaacatttgatgcctgt
attcgcttccttggagaggatccatgggagagaattcgtgagattaaaaaagtaatgcca
aatactccacaacaaatgttgttgagagctcaaaatcttctaggttataggcattacagt
gatgatgtagttagaaagtttgtggatcgatgtgcagataatggtgttggtgttttaaga
atatttgatgctatgaatgatgtccgtaatcttgaaactgcaattgatcaaactataaaa
gttgaccagcatgcccaaggtactatttcatatactgttagtcccgttcatacaattgaa
ttatggattgagatggccaaaagaattgaggatatgggtgctcattccctttgtattaaa
gatatggctggattattacaaccatatgttgcctttgagctagttaaaaaattaaaaaaa
gcgattgatattcctattcaattgcatgctcatgctacaacaggtttatctactgcatca
attattaaagcggttgaggctggcatagatcgtgttgatacttgtattggttctatgagt
atgacatacagtcactcagcaactaattcgattgtatctatattagaaaatagcccacgt
aaaactgggcttaatttggaaaaattagaagagattgaccaatactttaaaccaattaga
gctaagtattcaaaatttgaaggatctctgaagggtgtagattcaaggattctaacttct
caggttcctggaggtatgcttaccaatatggaagggcaactaaaagagcagaatgcaatt
gataaaatggatgaagttttattagagattcctagagtgcggaaagatcttggatatatt
cctctagttactcctacctctcaaattgttggtactcaagcagtgttgaatgtgctaact
ggagagagatataagactataactaaggagtcatcaggaatacttaagggggaatatggt
gcttctccagcaccactaaataaagagcttcaagatagagttctagaaggatcaaaagta
attacttgtcggcctgcagacaatcttaagccagagttagaaatacttgaagctgagttt
gataagatagtagctgataagggtataagggttgcagatgagaaggttgatgatttaatg
acatatgcacttttccctcaagttggtgttcagtttttagaaaatagagataacccagat
ttttttgagccagttcctcaagagcctagagaatttaaccctaacgataatagtgaaggt
atctataccgtatcatttgaaggtcaatcttatactgtaaatgttacttcaggtggtgat
atagcatcaattggctcttcttcagcagttacagaagttcataatatggtccaaaaggat
gctgaatcagatccttctaaatttacagctaaagaaaaggttgctgcgcctctatcaggg
actatatggaaggttctagtaagccctaatcaaagcattaatgaaggagatacactcctt
attttggaggctatgaaaatggagactgaggtaaaagcaacaagaactggaactgttata
agtgttgatgttaaagagggtgattcagtaactgttggccagttacttctctcattaaga
tag

DBGET integrated database retrieval system