KEGG   Candidatus Thioglobus sp. NP1: CRN91_05545Help
Entry
CRN91_05545       CDS       T05818                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
thin  Candidatus Thioglobus sp. NP1
Pathway
thin00450  Selenocompound metabolism
thin00970  Aminoacyl-tRNA biosynthesis
thin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CRN91_05545
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CRN91_05545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:thin01007]
    CRN91_05545
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:thin03016]
    CRN91_05545
Enzymes [BR:thin01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CRN91_05545
Amino acid related enzymes [BR:thin01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CRN91_05545
Transfer RNA biogenesis [BR:thin03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CRN91_05545
 Prokaryotic type
   Other AARSs
    CRN91_05545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AXE62126
UniProt: A0A344W9P1
Position
1075455..1077095
Genome map
AA seq 546 aa AA seqDB search
MSKRRILVTSALPYANGEIHLGHLLEYIQTDIWVRFQKTQGHECHYVCADDAHGTPIMLK
ADEMGIEPEALIAEVSKRHQSDFSDFNINFSQFHSTHSEENRYFSELIYSRLKDSGFIEK
RVISQAFDPEKEMFLPDRFIKGECPKCGADDQYGDNCEACGATYSTTELKNARSVVSGAI
PIEKDSEHYFFDLPQFEDQLKEWTNAGHLQDEVSNKLAEWFEQGLQQWDISRDKPYFGFQ
IPGTEDKYFYVWLDAPIGYMASFKKLCDNSDLEFDDFFAKGSDTELYHFIGKDIVYFHAL
FWPATLMGSNFRTPNAIFAHGFLSVNGQKMSKSRGTFIQARTYLDSFNPECLRYYYAYKL
SAKIDDIDLNLEDFKQRVNSDIVGKVVNIASRSASFVTKKFEKELSSLCIEQDLYDEFVA
ANSEIAQHYEARNFGHAMRSIMKLADKANQYIDDKKPWQLIKEEGREQEVHEITSLAINL
FRVLMTYLKPVLPEMAKQSEVFLNIDSLNWDDVKTPLLSHQINKFKPLMTRIEDEQIEAM
VESSKG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacgaagaatacttgttacttctgcactgccttatgctaatggtgaaattcat
ttagggcatctgctcgaatatattcagactgatatctgggttagattccaaaaaacgcag
ggtcatgaatgtcactatgtatgcgcagatgatgcccatggcacaccaattatgcttaag
gccgatgagatgggtatcgagcctgaagcgttaattgctgaagttagcaaaagacatcag
tcagactttagtgattttaatattaactttagtcaatttcattcaactcattcagaggag
aatcgttatttttcagagttaatctattccagacttaaggattcaggttttatcgaaaaa
cgcgttatttcgcaagcatttgatcctgaaaaggagatgtttctacccgatcgatttatt
aagggtgaatgtcctaaatgtggggctgatgatcagtacggcgataattgtgaggcatgt
ggtgcaacttattcaactacagagcttaaaaatgccaggtcggttgtttctggtgctatt
ccaattgagaaggactctgagcattatttctttgatttgccgcagtttgaagatcaactt
aaggaatggacaaatgctgggcatcttcaggatgaagttagcaacaaattagcagaatgg
tttgagcaaggccttcagcagtgggatatttcaagagataagccctattttggttttcaa
atcccaggtactgaagataaatatttttatgtctggcttgatgcaccaattggttatatg
gcaagctttaaaaagctttgtgataatagtgatcttgagtttgatgatttctttgctaaa
ggctctgatactgagctttatcactttattggcaaggatattgtttactttcatgcgcta
ttttggcctgcgactctaatgggctcaaactttagaacgcctaatgcaatatttgctcac
ggtttcttatcggtaaatggtcaaaaaatgagcaaatcacgtggaacctttattcaggca
aggacttacctagactcttttaatccagagtgtcttcgttactactatgcctataagcta
tcagcaaagatcgatgacattgatttaaacctagaagacttcaagcagcgtgttaattca
gacatagtcggcaaggttgtcaatattgcctcaaggagtgcatcctttgtcactaagaag
tttgagaaagagctatcgagtctgtgtatagaacaagacctctatgatgagtttgtggct
gctaatagtgaaattgctcaacattatgaggctagaaactttggacacgctatgcgctca
attatgaagcttgcggataaagcaaatcagtacatagatgacaagaagccttggcagcta
ataaaagaagagggtagggagcaagaagtccatgaaataacctcacttgctattaattta
tttagagtgttaatgacttatctaaaaccagtacttccagaaatggcaaaacagtctgaa
gtcttccttaatatagattcacttaattgggatgatgttaaaactccccttttgagtcat
caaattaataagtttaagcctttaatgactcgtattgaggatgagcaaatcgaggcgatg
gttgaatcgtccaaagggtaa

DBGET integrated database retrieval system