KEGG   Candidatus Thioglobus sp. NP1: CRN91_06060Help
Entry
CRN91_06060       CDS       T05818                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
thin  Candidatus Thioglobus sp. NP1
Brite
KEGG Orthology (KO) [BR:thin00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CRN91_06060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AXE62221
UniProt: A0A344W9Y6
Position
1172407..1172784
Genome map
AA seq 125 aa AA seqDB search
MTMKNKIEVNVAVTYLAGQSNIPNAQYAYAYTITITNNGETGAQLRTRHWIIQDESGEVE
EVVGEGVIGQQPHLSPGESFEYSSGAIISTETGSMKGSYGMINDQGQRFDAIIPEFTLSE
PYTLH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgactatgaaaaacaaaattgaagttaatgttgcggtaacctaccttgcaggtcaatct
aatattcctaatgctcaatatgcatatgcttacaccattacgattactaataatggggaa
actggtgcgcagcttagaactcgtcactggataattcaagatgaatctggagaagttgag
gaagtcgttggtgagggtgtgattggacagcaaccccatctctccccaggagagagcttt
gagtatagctcaggagcaatcattagcactgaaacagggtctatgaagggctcttatgga
atgattaatgatcaaggtcaacgctttgatgcaataatcccagagttcaccttaagtgag
ccctatactcttcactag

DBGET integrated database retrieval system