KEGG   Candidatus Thioglobus sp. NP1: CRN91_07035Help
Entry
CRN91_07035       CDS       T05818                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
thin  Candidatus Thioglobus sp. NP1
Pathway
thin00071  Fatty acid degradation
thin00280  Valine, leucine and isoleucine degradation
thin00310  Lysine degradation
thin00362  Benzoate degradation
thin00380  Tryptophan metabolism
thin00620  Pyruvate metabolism
thin00630  Glyoxylate and dicarboxylate metabolism
thin00640  Propanoate metabolism
thin00650  Butanoate metabolism
thin00900  Terpenoid backbone biosynthesis
thin01100  Metabolic pathways
thin01110  Biosynthesis of secondary metabolites
thin01120  Microbial metabolism in diverse environments
thin01130  Biosynthesis of antibiotics
thin01200  Carbon metabolism
thin01212  Fatty acid metabolism
thin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:thin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CRN91_07035
   00630 Glyoxylate and dicarboxylate metabolism
    CRN91_07035
   00640 Propanoate metabolism
    CRN91_07035
   00650 Butanoate metabolism
    CRN91_07035
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CRN91_07035
   00072 Synthesis and degradation of ketone bodies
    CRN91_07035
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CRN91_07035
   00310 Lysine degradation
    CRN91_07035
   00380 Tryptophan metabolism
    CRN91_07035
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CRN91_07035
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CRN91_07035
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CRN91_07035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thin04147]
    CRN91_07035
Enzymes [BR:thin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CRN91_07035
Exosome [BR:thin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CRN91_07035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AXE62405
UniProt: A0A344WAH0
Position
complement(1372280..1373464)
Genome map
AA seq 394 aa AA seqDB search
MNQEIVIVAATRTAIGSFGGLLAKVPAHKLGAQVIKSLLDSTSVDRAQIDEVILGQVLTA
GSGQNPARQAAIAAGLAYETPSMTINKVCGSGLKAVQLAFQAIACGDADIVIAGGQENMS
LSGHVLPRSREGKKMGPWEMVDTMVVDGLWCVFNDYHMGVTAENIATKFEFTRKAQDQFA
LESQQKAENAQKLNLFKDEITPILIPQKRGDDVVFDTDEYPRHGTTEETLSKLRPAFKKD
GTVSAGNASGINDGAAAVMVMSFAKAKELRLKPMARIVSYASAGVDPAIMGTGPIPASTK
CLEKAGWKVSDVDRIEANEAFSAQAMSVNDSLGFDKSKVNVTGGAIALGHPIGASGARIL
VTLLHGMQRDKVNKGLATLCIGGGMGVAMAVERI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagaaattgttattgttgctgcaacaagaactgcaatagggtcatttggtggt
ttactcgctaaagttccagcacataaattaggtgctcaagttataaagtctttattagat
tcaactagtgttgatagagcacagattgatgaggttattttgggtcaagttcttaccgct
ggaagtggtcagaatccagctcgccaagcagctattgctgctggtttggcttatgaaact
ccatcaatgacaataaataaggtttgtggcagtggtttaaaggcagttcaattagccttt
caggctatagcgtgtggcgatgcagatatagttattgcgggtggtcaggaaaatatgagt
ctttcagggcatgttcttccaaggtcaagagagggtaaaaagatgggtccttgggagatg
gttgatacaatggtcgtagatggtctatggtgtgtatttaatgactatcatatgggcgta
actgccgaaaatattgctactaaatttgaatttaccagaaaagctcaagaccagtttgca
ttagaatcacaacaaaaggctgagaatgcccaaaaattaaatctttttaaagatgaaata
acaccaatcttgatcccacaaaaaagaggggatgatgttgtttttgataccgatgaatat
cctagacatggaactacagaagaaacactttcaaaacttagaccagcatttaaaaaagac
ggaactgtttcagctggaaatgcatcaggcattaatgatggtgctgcagcagtaatggtt
atgagtttcgccaaagcaaaagaacttagacttaagcctatggctaggattgtctcctat
gcaagtgcaggagttgatccagcaattatgggtacaggtccaattccagcaagtaccaaa
tgtcttgagaaggcgggctggaaagtttcagatgttgatagaatagaagcaaatgaggca
ttttctgcacaagctatgtcagttaacgattctcttggatttgataagtctaaagttaat
gtaactggaggtgcaattgcacttggtcatccgataggagcctcaggagctagaatatta
gtaacgcttcttcatggaatgcagcgtgataaagtcaacaaagggcttgcgactctttgt
attggaggtggaatgggtgttgcaatggcagttgaaagaatttaa

DBGET integrated database retrieval system