KEGG   Thiomicrospira sp. S5: AYJ59_02840Help
Entry
AYJ59_02840       CDS       T05796                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
thio  Thiomicrospira sp. S5
Pathway
thio00670  One carbon pool by folate
thio00790  Folate biosynthesis
thio01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thio00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AYJ59_02840
   00670 One carbon pool by folate
    AYJ59_02840
Enzymes [BR:thio01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AYJ59_02840
    1.5.1.50  dihydromonapterin reductase
     AYJ59_02840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase RmlD_sub_bind TrkA_N GDP_Man_Dehyd PRNT
Motif
Other DBs
NCBI-ProteinID: AZR81316
UniProt: A0A3Q9I2E7
Position
633228..633935
Genome map
AA seq 235 aa AA seqDB search
MLKDAVLITGAGQRIGLYLAKQFLAQGQVVVFTYRTERPAVDELKAQGALGFQVDFTDSA
SLNTFLQCLPQQVASLRAVVHNASLWATDVQVDANPGLLADLLAVHVEAPYRINQACRPL
LEKTSAATADIVALTDVKVADGHADYAAYLASKAGLASLTQSFAQAFAPHIKVNNIAPGL
VIFHPEDSDAYRQKRLAESAIPVEPGEASIWQAVRFLMDSPNATGSTVSLGQKKA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagacgccgttttgattaccggagccgggcagcgcatcggcttgtatctggcg
aaacaatttttggcgcaaggccaagtggtggtctttacgtaccgcaccgaacgtccggcg
gtggatgagctgaaagcgcagggcgctttggggtttcaagtggatttcaccgattccgct
tctttgaacaccttcttacaatgtttgccgcagcaggtcgcgagcttgcgtgcggtggtt
cacaatgcatcgctctgggcgaccgatgtgcaagtggacgccaacccgggcttgctggcc
gatttgctggcggtgcatgtggaagcgccgtatcgaatcaaccaggcctgccgcccgtta
ctggaaaaaacgtccgcggccacggcggatattgtggcgttgacggatgtgaaagtggca
gacggccatgccgattatgcagcttatctggcgtcgaaggcgggtttggcctccttgacc
caatcgtttgcccaggcgtttgcgccgcacattaaagtcaataacattgcacccggcctg
gtgatttttcatcctgaagattccgacgcgtatcgccagaagcgtttggcggaaagcgcc
attccggtggaaccgggcgaggcatcgatttggcaagcggtgcgatttctgatggacagc
ccgaatgctacgggctcgaccgtgtcactcgggcagaaaaaagcgtaa

DBGET integrated database retrieval system