KEGG   Thiomicrospira sp. S5: AYJ59_10355Help
Entry
AYJ59_10355       CDS       T05796                                 

Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
thio  Thiomicrospira sp. S5
Brite
KEGG Orthology (KO) [BR:thio00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:thio03036]
    AYJ59_10355
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:thio04812]
    AYJ59_10355
   02048 Prokaryotic defense system [BR:thio02048]
    AYJ59_10355
Chromosome and associated proteins [BR:thio03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    AYJ59_10355
Cytoskeleton proteins [BR:thio04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   AYJ59_10355
Prokaryotic defense system [BR:thio02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    AYJ59_10355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsZ_C Tubulin Tubulin_2 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AZR82643
UniProt: A0A3S9TQ15
Position
complement(2235059..2236255)
Genome map
AA seq 398 aa AA seqDB search
MKFNLQETISADAGMPKIKVVGLGGGGGNAVDYMVRSEVEGVDFICANTDVQALKNANVE
TCIQLGANGLGAGANPEKGMEAAKENIEQVKEALKGADMVFITAGMGGGTGTGSAPVVAQ
AAREMGILTVGVVSKPFSFERRGKVAEAGIQQLAEHVDSLITVPNDKLLKVLGKDFVLAK
AFDYANEVLHGAVQGISELVTRPGMINVDFEDLRTVMTERGVAMMGVGHATGEARAVKAA
EKAIANPLLEDISVSGARGLLVNITSGLDFTLGEFNEVGDVIDQVASEDAKVIIGTSIDE
SMNDEIRVTVVATGLCEVAEAKRPEVVKPNLQAVEASKAEEKQEVQRHAAPKAEAAPEVS
KSPETVRPKMVVNGGVTGSVDSSSNYLDIPAFLRRQVD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttaatttacaagaaaccatttccgcagatgcgggcatgccgaagatcaaagtc
gttggtctaggcggtggtggcggtaatgccgtcgattatatggtgcgctcggaagtcgag
ggcgtcgattttatctgtgctaataccgatgttcaggcgttgaaaaacgccaatgtcgaa
acctgcattcagttgggtgccaatggtttgggcgcgggtgcgaatcctgaaaagggcatg
gaagccgccaaggaaaatatcgaacaggtgaaagaagcgctgaaaggcgcggatatggtg
tttatcactgccggtatgggcggtggcactggaaccggttctgctccggttgttgcacaa
gccgcccgtgaaatgggtatcttaaccgtcggtgttgtcagtaagccgttcagcttcgag
cgtcgtggcaaggtggcggaagccggtattcagcagttggcagaacatgtcgattctttg
attacggtgccgaacgacaagttgcttaaggtgcttggaaaagattttgtattggcgaaa
gcgtttgattacgccaacgaagtattgcacggtgccgtgcaagggatctcggaattggtc
actcgtccgggcatgatcaatgtcgactttgaggatttgcgtaccgtaatgacggaacgt
ggtgtcgccatgatgggtgtcggacatgcgactggtgaagcccgtgcggtgaaagcagcg
gaaaaagcgattgccaacccgttgctggaagacatttcggtttccggtgcgcgcggtctg
ttggtcaatattacatccggcttggatttcaccctgggtgaattcaacgaagtgggtgac
gtgattgatcaagtggcgtcggaagatgccaaggtcattatcgggacgtcgattgacgaa
agcatgaatgatgaaattcgtgtcactgtcgtggcaaccggtttgtgcgaagtggcggaa
gccaaacgcccggaagtggtgaagccgaatttgcaggcggttgaagccagcaaagccgaa
gaaaaacaagaagtgcaacgccatgccgcgccgaaagccgaggctgcaccggaggtgtcc
aaatcaccggaaacggttcgtccgaaaatggttgtgaacgggggtgtcaccggcagcgtg
gattccagttccaactacttggacattccggcgttcttgcgtcgccaagtcgattaa

DBGET integrated database retrieval system