KEGG   Tarenaya hassleriana (spider flower): 104800850Help
Entry
104800850         CDS       T04125                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 3, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00071  Fatty acid degradation
thj00592  alpha-Linolenic acid metabolism
thj01040  Biosynthesis of unsaturated fatty acids
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
thj01212  Fatty acid metabolism
thj04146  Peroxisome
Module
thj_M00087  beta-Oxidation
thj_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104800850
   00592 alpha-Linolenic acid metabolism
    104800850
   01040 Biosynthesis of unsaturated fatty acids
    104800850
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104800850
Enzymes [BR:thj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     104800850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 104800850
NCBI-ProteinID: XP_010522108
Position
Unknown
AA seq 680 aa AA seqDB search
MSDQSRALRRTQILTNHILRSPSPASNSSLSPEVCLQYSPPQLNESYGFDIKEMRKLLDG
HNVEDRDWLYGLMIQSNLFNRRERGGKIFVSPDYNQTMEQQREITMRRIWYLLEKGVFQG
WLTKTGAEAELKKFSLLEICGIFDHSLAIKIGVHFFLWAGAIQFFGTRRHHEKWLKDTED
YVVKGCFAMTELGHGSNVRGIETVTTYDPRTGEFIINTPCESAQKYWIGGAANHATHTIV
FSQLDINGTNQGVHAFIAQIRDQDGNVCPNIRIADCGHKIGLNGVDNGRIWFDNLKVPRE
NLLNSVADVSPDGQYVSAIKDPDQRFAAFMAPLTSGRVTISASAVYSAKMALAIAIRYSL
SRRAFSIAANEPEVLLLDYPSHQRRLLPLLAKTYAMSFAANYLKMIYVKRTPETNKIIHV
VSSGFKATLTWHNMRTLQECREACGGQGLKTENLVGILKGEFDVQTTFEGDNNVLMQQVS
KALFSEYVSCKKRNKPFKGLGLEHMNSPRPVLPSQLTSSTLRCSQFQTNVFCLRERDLLE
RFSAEVSQHQGKGESREYSFMQNHQLAEDLGRAFAEKAILQTILEAEAKLPAGSVKDVLG
MVRAMYGLICIEEDASFLRYEYLSTDGIGAVRREVSKLCGEMRPHALSLVTSFGFPDSFL
SPIAFNWVEANAWPSALHHH
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatcaaagccgcgctcttcgacgaactcaaattctcaccaatcacatactccgg
tcgccttctccggcgtcaaattcatctctttctccggaggtatgtttgcagtactctcct
ccccagctcaacgagagttatggcttcgacatcaaggagatgaggaaattgcttgatgga
cacaacgtcgaggacagggattggctgtatgggctaatgattcagagcaatttgttcaat
cggagggagagaggcgggaagatcttcgtgtctccggattacaaccagacgatggagcag
cagagggagataacgatgcgacggatttggtacttgttggagaaaggggttttccagggc
tggttgacaaagacgggtgccgaagccgagctcaagaagttctctctccttgaaatttgc
gggattttcgatcactctctcgccattaaaatcggcgttcatttcttcttgtgggctggt
gctattcagttttttggcacaagacgccaccacgaaaagtggctgaaggacactgaagat
tatgttgtgaagggttgctttgcaatgactgagttgggtcatggaagtaatgtgcgagga
attgaaacagtgactacttatgacccaagaactggagagtttatcataaacactccttgt
gaatctgctcagaagtattggatcggtggggcagctaatcatgcaacacatacaattgtg
ttttcacagcttgatataaacggaaccaatcagggtgtccatgcttttatcgcccaaatc
agggaccaagatggcaatgtatgtccaaacatacgcatagctgattgtggacacaaaatt
ggtctaaatggagtagacaatggccgcatatggtttgacaatctcaaagttccaagagag
aatttattgaactcagttgccgatgtctcaccggatggacagtatgttagcgcaataaag
gaccctgatcagcggtttgcagcattcatggctcctttgacctcaggccgtgtcacaatt
tcagcaagtgcagtttattcagctaagatggctttagctattgcaataaggtactcgtta
tctaggagagccttctccattgcagcaaatgagcctgaagttctcctgcttgattaccca
agccatcaaaggcgactactgcctcttctggctaagacatatgcaatgagcttcgctgca
aattacttgaagatgatttatgtgaagaggacacctgagaccaacaaaatcatccatgtt
gtttcgagtgggttcaaagccactctcacctggcacaatatgcgaacacttcaggaatgc
cgtgaagcttgtggagggcaaggtctgaaaacagaaaaccttgtgggtattctgaaaggt
gaattcgatgtgcagactacgtttgagggtgacaataatgtgttgatgcagcaggtgagc
aaggcacttttcagcgaatacgtgtcttgtaagaaaaggaacaaacctttcaaaggatta
gggttggagcacatgaatagtcctcgtccggtcctgccatctcaactcacatcttctacc
ctcagatgcagccagttccagacaaatgttttctgtttaagagagcgagatctgctagaa
cgattttccgctgaagtctcgcagcatcaagggaagggagaaagtagagagtactccttc
atgcagaatcatcagctggctgaagaccttggtcgggcttttgcggaaaaagccatactc
caaaccattttggaggctgaggccaagcttcctgctggttcagtaaaagacgttttggga
atggtgagagcgatgtatggcctcatctgcatagaggaagatgcatcgtttctgagatat
gagtatctgtcaacggatggcatcggagcagtgaggagagaagtgtcgaagctgtgtgga
gagatgaggcctcacgctctctctctcgtcacctcctttggattccccgactctttcctg
agccccatcgctttcaactgggtcgaagccaatgcttggccctctgctcttcatcatcac
taa

DBGET integrated database retrieval system