KEGG   Tarenaya hassleriana (spider flower): 104802240Help
Entry
104802240         CDS       T04125                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like
  KO
K03252  translation initiation factor 3 subunit C
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj03013  RNA transport
Brite
KEGG Orthology (KO) [BR:thj00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    104802240
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:thj03012]
    104802240
Translation factors [BR:thj03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    104802240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI RP-C_C
Motif
Other DBs
NCBI-GeneID: 104802240
NCBI-ProteinID: XP_010524039
Position
Unknown
AA seq 885 aa AA seqDB search
MASRFFAQGGSDSEDESEYEEEVDEVPGGDSAGGINSRYLPGNASDSDDSDGQRRVVRSA
KDKRFEEMTSTIEQMKNAMKINDWVSLQENFEKLNKQLEKVMRVTEAVKVPTMYIKTLVM
LEDFLNQTLANKEAKKKMSPSNSKALNSMKQKLKKNNKQYEDAINKYRESPESEGEKEEE
DDEDEDEEEEDEFEEDVPNLGPESEEEDEEESADKGDRSWEKMLSRKDKLMDKLFMKDPK
EITWDTVNKKFKEIVAARGRKGTGRFEQVEQLTFLTKIAKTPAQKLEILFSVISAQFDVN
PGLSGHMPINVWKKCVQNMLTILDILVKYTNIVVDDTVEPDENETQKPADFDGTIRVWGN
LVAFLERIDTEFFKSLQCIDPHTREYVERLRDEPMFLALAQNIQDYIERVGDLKACAKVA
LRRVELIYYKPQEVYDAMRKLAELVEADEESEEPNEGAGPPSSFIVVPEVVPRKPTFPES
SRAMMDILVSLIYKYGDERTKARAMLCDIYHHALMDKFSTARDLLLMSHLQDNIQHMDIS
TQILFNRTMAQLSLCAFRAGMITEAHSCLSELYSGQRVRELLAQGVSQSRYHEKTPEQER
LERRRQMPYHMHINLELLEAVHLICAMLLEVPNMAANSHDGKRKLISKNFRRLLEMSERQ
AFTGPPENVRDHVMAATRALTRGDFQKAFDVLNSLDVWRLLKNRETVLDMVKARIKEEAL
RTYLFTYSTSYESMGLDQLAKMFDLSEAEVHSIVSKMMVNEEIHASWDQPSRCIVFQEVK
ESRLQALAFQLTEKLSILAESNERAMEARTGGGGLDLNARRRDNTQDYAAAVAGGVSSYT
QGRRGGGGRMSGIGHQNREWSGQNRRGGSGNSSGRMVSLNRGNRA
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcgtttttttgcccagggtggaagtgacagtgaggacgagagtgagtatgag
gaagaggtcgatgaggtcccaggcggtgattctgccggtgggattaattcacgttacctt
ccaggtaatgcaagtgacagcgatgattctgatgggcagaggcgtgtggttaggtcagcc
aaagataagcgttttgaagagatgacaagcaccatagaacagatgaagaatgccatgaag
atcaatgactgggttagcctgcaggagaattttgagaaactcaacaaacagctggaaaag
gtcatgagggttacggaggctgtgaaggttcctacaatgtacatcaaaacccttgtgatg
ttggaggacttcttaaatcaaactctggcaaataaggaagccaagaagaagatgagcccc
agtaactccaaggcattgaactcgatgaaacagaaattgaagaagaacaataagcagtat
gaagatgcaattaataagtatagggagtctccagagagtgagggagagaaggaagaggaa
gatgatgaagatgaagatgaggaagaggaagacgagtttgaggaagatgttccaaaccta
gggccagaatctgaagaagaggacgaggaggaatctgcagacaagggggatcgctcgtgg
gagaagatgctcagtaggaaagataaacttatggataagttgtttatgaaagatcctaag
gagattacatgggatactgtcaacaagaagttcaaagaaattgtggctgcccgtggtagg
aagggaaccggtcgatttgaacaggttgaacagcttacattcttgaccaagattgccaag
actcctgcacagaagctcgaaatcttgtttagtgttatttctgcgcagtttgatgtgaat
ccaggtctcagcggacacatgcctatcaatgtctggaagaaatgtgtgcagaacatgctc
accatactggacattcttgtcaagtacactaacattgttgtggatgatacagttgaacct
gatgagaatgaaactcaaaaaccagctgattttgacggaacgattcgggtctggggtaac
ttggttgccttcttagagaggatagataccgagtttttcaagagcttgcagtgcatagat
cctcacactcgcgagtatgtagagagactgagggacgaacccatgtttttggctcttgct
cagaacattcaggactacatagagcgagttggggatcttaaagcttgtgccaaggtagcc
ttaagacgagttgagcttatttactacaagccacaggaagtttatgatgctatgaggaaa
ttggctgagttggtggaagcagatgaagaaagtgaggaaccgaatgagggagctggacct
ccatcttccttcatcgtcgttccggaggtggtccctcgtaagcccaccttcccagagagt
agccgagctatgatggatattctcgtgtctcttatttacaagtacggagatgagcggacc
aaagcccgtgcaatgctttgcgatatctaccaccatgctttgatggacaagttttcgact
gctagagatttgttgctgatgagtcatctgcaggacaatattcagcacatggatatctcg
actcaaatcctcttcaacaggaccatggctcagctcagtctctgcgcattccgggctgga
atgatcactgaggctcacagctgcctttctgagctgtattctggtcaaagggtgagggag
ttgctcgctcaaggtgtctctcaaagtcggtatcatgagaagacccccgagcaggaaagg
ttggaaagaagaagacaaatgccgtaccacatgcacataaatctcgagcttctggaggct
gttcatctcatctgtgcaatgctgctggaggtccccaacatggcggccaactcgcatgac
ggcaaacgcaagctgataagcaagaatttccgccgcttgctcgagatgagcgagaggcaa
gcattcaccggccctcccgagaatgtacgtgaccacgtgatggcagccacccgagccctc
accagaggggacttccaaaaggcctttgacgttttgaactccctcgatgtctggaggctg
ctcaagaaccgggaaaccgtcctggatatggtgaaggccaggatcaaagaagaggcacta
aggacgtatctctttacgtactcgacctcttacgagtcgatgggcctcgaccaattggca
aagatgtttgatttatccgaggcagaggtccacagcattgtgagcaagatgatggtaaac
gaagagatacatgcgagctgggaccagccaagccgatgcatagtcttccaggaagtgaag
gagagcaggctacaagcactggccttccagttaacggagaagctatcgatactggcagaa
agcaatgagagggcaatggaggcgaggacaggtggtggaggacttgatcttaacgcaagg
agaagggacaacacacaggactatgcggcggctgtagcaggaggagtgtcatcatacaca
caaggaagacgaggaggaggtgggcgaatgtcggggattggtcaccagaacagggaatgg
agtggtcagaaccgaagaggcggctcggggaacagctcgggccgcatggtcagtcttaac
cgaggaaaccgtgcctaa

DBGET integrated database retrieval system