KEGG   Tarenaya hassleriana (spider flower): 104802665Help
Entry
104802665         CDS       T04125                                 

Definition
(RefSeq) GPI transamidase component PIG-T-like isoform X1
  KO
K05292  GPI-anchor transamidase subunit T
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    104802665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 104802665
NCBI-ProteinID: XP_010524673
Position
Unknown
AA seq 646 aa AA seqDB search
MARFSPGSLPVLVLFFSRIFLVPIALGSADVEEFSEELLLKPLSDRKVLAHFHFESQAPP
SNSHGRHHHLFPKAISQLVQKFRVKEMELSFTQGRWNYERWGGFDPLSSMNTKPVGVELW
AMFDVPLSEVDASWKNLTHSLSGLFCASINFLESSTSYASPTWGFRPNSDKLRYGSLPCE
AVCTENLTPWLKLLPCRDKDGISALMDRPSIYRGFYHSQRLHLFTVDSGQEGLDSGIVLE
QTLTVVLRPDSGSSKKQIQPSWTLSSLFGRKIFGSCVLAKSSNVYLQLEGLPVHELKSVD
QELETNGLWKNAGFELSIEPDRVLQETNSFLFEFDIGEYNDSKPFDLGLTWKLPLKWSCG
QAPLHASRFLMGSGNERGAIAISLKLTETYEKFSGGDLGDGPCTLQANIFQVFPWYIKVY
YHTLQVFMDQQQRTVSEVVKNITVSPSTDKTSPGVMEMMLELPCRMKSAALSLEFDKGFL
HIDEYPPDANQGFDIPSALISFPNHHARLVFHEETSNSPLLSKLKEKSPVRSYTEILLVP
LTTPDFSMPYNVITITCTVFALYFGSLLNVLRRRVGEEERLLKSKAGNKQGKLLQLLSRI
SAKIRGRPVESSSSEASSSVMSSNFLLKVMLVAGIAATWQYFSTYM
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggccagattttcacctgggtcgcttccggtgcttgttttgtttttttctcggatattt
ctggtcccaatcgcacttgggtcggcagatgttgaagaattcagcgaggaattgctgttg
aagcctttgtctgatcggaaagtgttagctcacttccatttcgagagccaagctcctcca
tcgaattcacatggccgccatcaccatctcttcccgaaagctatttctcagctggttcag
aaatttcgagtcaaagagatggagctatctttcactcagggtcgttggaactatgaacga
tggggcggatttgacccgttgtcaagcatgaatacaaagcctgtcggggtcgagctgtgg
gctatgtttgatgttcctctgtctgaggttgatgcttcctggaagaacttgactcattca
ctttcagggcttttctgtgcttcgatcaactttcttgaatcttccacttcatacgcatcc
ccgacatgggggttcagaccaaactccgacaagctgaggtatggttcgctgccatgtgaa
gctgtctgtaccgagaatttgaccccttggttgaagttgcttccttgtagagacaaggac
ggaatttctgcgttaatggataggccatcaatctacagagggttctatcattctcagaga
ttgcatttgttcacggttgattctggacaagagggattggattccggcattgtgcttgag
cagacacttactgttgttcttcgccctgatagtggttctagcaaaaaacaaatacagcct
agctggaccctgagctctcttttcggtaggaaaattttcggaagttgcgttcttgcaaag
tcgagtaacgtgtatcttcagttggagggtcttccagttcatgaactgaagagtgtagat
caagaactagaaacaaatgggctctggaagaatgcaggtttcgaattgtctattgagcca
gacagggttcttcaagaaactaacagctttctatttgagtttgacattggcgaatacaat
gacagtaagccatttgatcttggccttacttggaagcttccattgaaatggtcttgtgga
caagctccattacatgctagtcggttcttgatgggaagcgggaatgaaaggggtgcaata
gcaatctcattgaaattgacggaaacatatgagaagttttcgggtggagatctcggtgat
ggtccatgcacactgcaggctaacattttccaagttttcccatggtatattaaggtttac
taccatactctgcaagtattcatggaccaacagcaaagaacagtcagcgaagtcgtaaag
aatatcactgtttcaccttcgacggataaaacgtcgcctggagtgatggagatgatgctg
gaactaccatgtaggatgaaatctgctgcattgtcgctagaatttgataagggtttcctc
cacattgatgaatatcctcctgatgctaaccaaggattcgacattccctctgctttgata
agctttccgaaccatcatgcacgattagtattccatgaagaaacaagcaactcgcctttg
ctatcaaaattgaaggaaaaatcgccagtccgatcttacacggaaatcttgctcgtgcct
ttgacaacccctgatttcagcatgccttacaacgtaatcacgatcacatgcacggtgttt
gcattgtattttggatcactgctcaatgttcttcgcagacgcgttggtgaagaagaaagg
ctactcaaaagcaaagcaggcaacaaacagggtaagcttctgcagttgttgtcaagaatt
tcagccaagattcgaggaagaccagtcgaatcatcatcatctgaagcttcttcatctgta
atgtcttctaattttctcctcaaagtcatgttagtcgccggaattgctgcgacatggcaa
tatttttccacttacatgtag

DBGET integrated database retrieval system