KEGG   Tarenaya hassleriana (spider flower): 104804035Help
Entry
104804035         CDS       T04125                                 

Definition
(RefSeq) tyrosine decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00350  Tyrosine metabolism
thj00360  Phenylalanine metabolism
thj00380  Tryptophan metabolism
thj00901  Indole alkaloid biosynthesis
thj00950  Isoquinoline alkaloid biosynthesis
thj00965  Betalain biosynthesis
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104804035
   00360 Phenylalanine metabolism
    104804035
   00380 Tryptophan metabolism
    104804035
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    104804035
   00950 Isoquinoline alkaloid biosynthesis
    104804035
   00965 Betalain biosynthesis
    104804035
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    104804035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thj04147]
    104804035
Enzymes [BR:thj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     104804035
    4.1.1.105  L-tryptophan decarboxylase
     104804035
Exosome [BR:thj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104804035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 104804035
NCBI-ProteinID: XP_010526485
Position
Unknown
AA seq 492 aa AA seqDB search
MENGGSELKPMDSEQLRECGHRMVDFIADYYRTIENFPVLSQVQPDYLRNLLPDSAPDQP
ENLEEVLSDVQEKILPGLTHWQSPNYFAYYPSNSSIAGFLGEMLSAGLNIVGFSWITSPA
ATELEMIVLDWLSQLLNLPEQFLSKGNGGGVIQGTASEAVLVVLIAARDKVLRKVGKDAL
EKLVVYASDQTHSSLQKACQISAIRPENCRLLKTDASTNYALSPESLQAAISHDLASGLI
PFFICASVGTTSSTAVDPLPALGRIAKDNEMWFHVDAAYAGSACICPEYRQYIDGIEEAD
SFNMNAHKWFLTNFDCSLLWVKDRNSLIQALSTNPEFLKNKASQANLVVDYKDWQIPLGR
RFRSLKLWMVMRLYGSEKLQCYIRNHINLAKHFEELVSGDSRFEIVTPRIFSLVCFRLKP
VDNDEDKCKKQNHELLDAVNSTGKMFISHTVLSGKFVLRFAVGAPLTEEKHVKEAWNNIQ
EQASKLLGVHAG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggtggtagcgagttgaagccgatggattcggagcagctgagagagtgcggg
catagaatggtcgatttcatcgctgattattacagaaccatcgagaacttccctgttctg
agccaagttcagcctgattatcttcgtaaccttttgccggattctgcgcctgaccaaccc
gagaatttggaagaagtccttagtgatgttcaggagaagatacttcctggattaacacat
tggcaaagcccgaattactttgcatattatccttctaacagcagcattgccgggttcttg
ggcgagatgctcagtgctggtctcaacatcgttggttttagctggattacttctccagct
gccacagagctcgaaatgattgttctagattggctttcccaattgctcaacctaccggag
cagttcctttcgaaaggaaatggaggtggagtgatacaagggacagctagcgaagctgtt
ctagttgtcctaattgctgcccgtgacaaggttttgagaaaggtagggaaagatgctctg
gagaagctcgtagtgtatgcatcggaccaaacacattcctccctgcagaaggcctgccag
ataagtgcaatccgtccggagaattgcagattgctgaaaactgatgcgtcaacgaattat
gcactctccccagaatcacttcaagcagcaatttcacatgatcttgcttcaggattgatt
ccattcttcatatgtgctagtgtaggtaccacttcttcaactgcagtcgatccattacct
gccttgggaaggatcgctaaggacaacgagatgtggtttcatgtggatgctgcatatgct
ggaagtgcctgcatatgtccagagtacaggcaatatattgatggaattgaagaagcggat
tcctttaacatgaatgctcacaaatggtttctcacgaatttcgattgttcgttactttgg
gtgaaggaccggaattctctcattcaggctctttcaacgaatcccgagtttcttaaaaac
aaggcctcccaggcaaacttggtcgtggactacaaagattggcaaatccctctggggaga
agattcagatcattgaaactgtggatggttatgcggctctatggatccgaaaaattgcaa
tgctatataagaaaccacatcaatctggctaaacatttcgaggagcttgtatctggagat
tctcgtttcgagatcgttactcctcggatattttcacttgtatgctttcgacttaaacct
gtcgacaacgacgaagacaagtgtaaaaaacagaatcatgagctactagatgccgtgaat
tcgaccgggaaaatgttcatttctcacactgttctgtcgggaaaattcgtgctacgtttt
gcggtaggagcgccgttaacggaggagaaacacgtgaaggaggcatggaacaatattcag
gaacaggcctccaaattgcttggcgtccacgcaggataa

DBGET integrated database retrieval system