KEGG   Tarenaya hassleriana (spider flower): 104804806Help
Entry
104804806         CDS       T04125                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00450  Selenocompound metabolism
thj00970  Aminoacyl-tRNA biosynthesis
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    104804806
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104804806
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:thj01007]
    104804806
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:thj03016]
    104804806
Enzymes [BR:thj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     104804806
Amino acid related enzymes [BR:thj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   104804806
Transfer RNA biogenesis [BR:thj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    104804806
 Prokaryotic type
   Other AARSs
    104804806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 DUF3952 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 104804806
NCBI-ProteinID: XP_010527469
Position
Unknown
AA seq 798 aa AA seqDB search
MAEEKSGPKLPIPGKRNILITSALPYVNNFPHLGNIIGCVLSADVFARYCRIRGYNSIYI
CGTDEYGTATETKALEENCSPKEICDKYHAIHKEVYDWFDILFDKFGRTSTPQQTEVCQA
IFKKLLKNNWLSENTMQQLYCETCKKFLADRLVEGTCPFEICNNDSARGDQCDKCGKLLN
PTELKDPRCKVCGTSPQIRDTDHLFLELPLLKDKLDEYINKTSVAGSWSQNAIQITNSWL
KEGLKQRCITRDLKWGVPVPLEKYKDKVFYVWFDAPIGYVSITSCYTSEWEKWWKNPENV
ELYQFMGKDNVPFHTVMFPSTQLGTEENWTLMKTISVTEYLNYEGGKFSKTKGVGVFGND
AKETNIPVEVWRYYLLTNRPEVSDTQFTWDDLQAKLNGELLNNLGNFVNRVLSFIAKPAG
QGYGSVIPDAPGAESHPLTNSMAEKVGKLVEQYVEAMEKVKLKQGLRIAMSISSEGNAYL
QESQFWKLYKQDEPSCSIVMRTACGIVNILARLLEPFMPSFSHEVFKQLNLPLQFSLSDE
NGDIFKASRPWEILPPNHKIGTPQPLFKELKDEEVQQYQEKFAGSQGDRRAREAEAANMV
EQLKKTQLSDGKKQKPSKASEAAKAKPKPAAEPEITITRLDIRVGKIVKVQKHPDADSLY
IEEIDVGEEKPRTVVSGLVKHIPLDEMQNRMVCVLCNLKPVKMRGIQSQAMVLAASNSDD
SKVELVEPPESAKIGERVKFLGLEGDADDVLNPKKKVWETLQPDLRTNDNLVAHFKALPF
TTSAGFCKVSSIKSGKIR
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagaaaagagcgggcccaagttgcctatcccgggcaaaagaaacatacttata
acaagcgctttgccttacgtgaacaatttccctcatctcggcaacatcatcggatgtgtt
ctaagtgctgatgtctttgctagatattgccgcatccgtggctataattccatatacata
tgtggtacggatgaatatggaactgcaaccgagaccaaagccttggaggagaattgcagt
ccaaaggagatctgtgataagtaccatgccattcataaagaagtttatgattggtttgat
atactttttgacaaatttgggcgaacttcaactccacaacagacagaagtttgccaggca
attttcaagaaattgttgaagaacaactggctatcagagaacaccatgcaacagctttac
tgcgagacatgcaagaaattcttagctgaccggcttgttgagggcacctgtccgtttgaa
atctgcaacaatgattctgccaggggagatcaatgtgacaaatgtggaaagctcctgaat
cctactgaactaaaagatccaaggtgcaaggtatgcgggacctcaccccaaattcgtgat
acagaccatctgtttcttgagcttcctttattaaaagataaattggacgagtacataaac
aaaacatctgttgctggatcgtggagtcaaaatgctattcaaataacaaattcgtggctt
aaggaagggctgaaacagagatgcattacaagggacctaaaatggggtgttcccgttcca
cttgagaaatataaggacaaggtcttttatgtttggtttgatgctcctattggatatgtt
tcgataacttcatgctatacatctgaatgggagaagtggtggaagaatcctgaaaacgtg
gaactttatcaatttatgggaaaagacaatgtgccatttcacactgtgatgtttccttct
acgcagctggggaccgaggaaaattggacactgatgaagacgatcagtgttactgaatat
ctaaattacgagggtggaaagttctccaagactaaaggggtaggagtgtttggcaatgat
gcaaaagaaacgaatattcctgtagaagtatggagatattacttgctgactaacaggcca
gaggtctctgacacacaattcacgtgggatgatttgcaagcaaaattgaatggcgagttg
ctgaacaacctaggcaactttgttaaccgtgttctgagttttattgcgaagcctgcaggt
caaggttatgggtctgtcattcctgatgctcctggcgctgaatcacatccattgacaaat
tcaatggcggaaaaggttggaaagctcgtagagcagtacgttgaagccatggagaaggtt
aagctaaagcagggtctgagaatagctatgagcatttcaagtgaagggaacgcatacttg
caggaaagtcaattctggaaactttacaagcaagatgaaccttcctgctcaattgtcatg
agaactgcttgcgggatagtaaatatccttgcacggcttttagaacctttcatgccatcc
ttttctcatgaggtatttaagcagcttaatttgcctttacaattttcactctccgacgag
aatggagacatatttaaagcaagtaggccatgggagattctacctcccaaccacaagatt
ggcactcctcaaccattgttcaaggaactgaaagatgaagaagttcaacaataccaagaa
aaatttgctggaagtcaaggtgatagacgtgcgagggaagcagaggcagcaaatatggtc
gagcaactgaagaaaacccaattatctgatggaaagaaacagaaaccatcaaaagctagt
gaagcagccaaagctaagccaaagccggctgctgaacccgagattaccattacaagactt
gatatacgtgttgggaaaatcgtgaaggtccagaaacatcccgacgcggattcattatac
attgaagaaatcgatgtcggagaagagaaacctcgcactgttgttagcggacttgtcaag
catatacctctcgacgaaatgcagaaccgcatggtttgtgttctgtgcaacttaaaaccc
gtgaaaatgagaggaattcaatcacaagcgatggttcttgcggcttcaaacagcgatgac
agtaaggtcgagttagttgaaccgcctgaatcggcaaagataggggaacgagtcaaattc
ctgggtttagaaggggacgcagacgatgtactgaacccgaagaagaaagtatgggagaca
ctgcagcccgatttacgaaccaatgacaatctcgttgctcatttcaaagctttgcccttc
accacttctgctggattctgcaaggtctcttccatcaaatctggtaaaatccgatag

DBGET integrated database retrieval system