KEGG   Tarenaya hassleriana (spider flower): 104805240Help
Entry
104805240         CDS       T04125                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00970  Aminoacyl-tRNA biosynthesis
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104805240
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:thj03029]
    104805240
Enzymes [BR:thj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     104805240
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     104805240
Mitochondrial biogenesis [BR:thj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    104805240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase DUF1455
Motif
Other DBs
NCBI-GeneID: 104805240
NCBI-ProteinID: XP_010528035
Position
Unknown
AA seq 529 aa AA seqDB search
MVSTLQPPRNFSLLRLRLIHSRPIVSVAAAPAASSLPESQILSTRRSLLTGEVTAVELAK
SYLSRLRLTEPHLKSFLHVSENVLKEADEIDKRISKGEDVGPLAGVLVGVKDNICTTGMP
STAASRILEHYHPPFDATAVRKFKELGGIVVGKTNLDEFGMGGTTETSAFQVTRNPWDVT
RVPGGSSGGSAAAVAARQCMVALGSDTGGSVRQPASFCGVVGLKPTYGRVSRFGLMAHAS
SLDVIGCLGSTVADAGILLHAISGHDRFDPTSSKQEVPDFPSLFPSLDSFESKPLKGVKV
GLIRETLEVGVDPGVKSVTQEAASYLEALGCDLTEVSMPAFSLGWPAYYVIASSESSSNI
ARYDGLRYGNQATADELNKVYEDSRGKGFGWEVKMRLLMGTYALSEGYYDAYYKRAQKVR
TLIQKDFKAALDHNDILISPAAPSAAFKIGEKRDDPLEMYAGDIMTVNVNLAGVPAIVLP
CGLVEGGPSGLPVGLQMIGSAFDEAKLLKVAHIFEQTLKGSSFVPPLHC
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggtttccacattgcagccgccacgcaacttctccctcctccgtctccgcctcatccac
tccagacccattgtctccgtcgctgccgcccccgctgcttcatctctgccggagtctcag
atcctcagtacccgccgttccctcctcaccggagaggttaccgccgtcgaacttgcgaag
tcttacctttcccgcctccgtctcaccgaaccgcacctcaagtccttcctccacgtgtcg
gagaatgtcctgaaggaggcagacgagatcgacaagcgaatttccaaaggtgaggatgtg
ggtcctctcgcaggagttcttgtcggcgtcaaggataatatctgcacgacgggtatgcct
tctactgcggcctctcgcatcctcgagcactatcacccaccgttcgatgcgacggcggtc
aggaagttcaaagagcttggagggattgtggttggaaaaaccaatttagacgaattcgga
atgggtggcacaactgaaacttctgctttccaggtgactaggaacccgtgggatgtaacc
cgtgtaccaggagggtcttcggggggctcagcggcagctgttgcagccaggcaatgtatg
gtggctcttggaagtgacactggtggtagtgtgaggcagccagcatcgttctgtggcgtt
gttggtcttaagccaacatatgggcgtgtctcaagatttggtcttatggctcatgcctct
tctctggatgtaattgggtgccttggttctactgttgctgatgctggaattcttcttcat
gccatctctggtcatgatagattcgaccctactagtagcaaacaggaggtgcctgatttt
ccgtctctgtttccttctttagactcttttgaatctaaaccactgaagggagtgaaagtt
ggtctgattcgcgagactcttgaagttggtgttgatcccggagtgaaatctgtaactcag
gaagctgcatcatacttagaagccttgggttgtgatttgacagaggtgtcaatgcccgca
ttttctcttggatggccagcctattatgtgattgcctcatcggaatcctcctccaacata
gcacgttatgatggcctcagatatgggaatcaagctactgctgatgagctaaacaaagtg
tatgaagattcccggggtaaaggatttggctgggaggtgaaaatgagacttttaatggga
acatatgccctgtcggagggttactatgatgcctactacaagcgagctcaaaaggtgagg
acattgatccagaaagacttcaaggcagcgctagatcataacgacatccttatctctcca
gcagctccttctgcagcattcaagatcggtgaaaagagagatgatccattagaaatgtac
gctggagacattatgacggtcaatgtaaacttggcgggggttcctgcaatagttctaccc
tgtggattagtagagggaggaccttcaggtcttcctgttggccttcaaatgatcggttca
gccttcgatgaggcaaaactgctcaaagtggcccatatatttgagcagacacttaaaggt
tccagctttgttcctccactccactgttag

DBGET integrated database retrieval system