KEGG   Tarenaya hassleriana (spider flower): 104806277Help
Entry
104806277         CDS       T04125                                 

Definition
(RefSeq) sphingosine kinase 1 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00600  Sphingolipid metabolism
thj01100  Metabolic pathways
Module
thj_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    104806277
Enzymes [BR:thj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     104806277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat Tim54 NYN
Motif
Other DBs
NCBI-GeneID: 104806277
NCBI-ProteinID: XP_010529399
Position
Unknown
AA seq 490 aa AA seqDB search
MDKRLENEQEHGPAIISDQVLVNGIATPLMLTADGELWWMGAVRRSLTVEKDVIGFSIEG
SKVRVKAVVERGGGGICGGGIAGDCVRKDFVFEPLSDYSRNLWRHKLGECLDSLGRPKKL
FVFVNPYGGKKSARTIFQEEVKPLLEAADIQLEVKETKYQLHAKEIVRSLDLAEYDGIVC
VSGDGILVEVVNGLLEREDWRNAIRTPIGMIPGGTGNGMIKSLLDSVGLQCSARSATISV
IRGHKRSLDVATILQGDTRFFSILMLAWGLVADIDIESEKFRWMGSARLDFYALQRIIRL
RRYNGRVLFVPAPGFEGYGQPASYEARSRASSDKAPSVEAKKLGYQGPNTETRNQEWREI
NGPFVSVWLHNVPWGAENTLAAPDAKFSDGFLDLILIKDCPKLALLSLMTKLTDGGHVKS
PYTMYLKVKEFVLEPGARVEDPDKDGIIDSDGEVLARGRRTYNSDHKALMSYSELRVTVD
QGLATLFSPK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggataagcggctggaaaacgaacaagagcatgggccggcgataatctccgaccaggtt
ctggtcaacgggattgccacgccgttgatgttgaccgccgacggagagctctggtggatg
ggggctgttcgccggagtttaacggtggagaaggacgttatcggattctccatcgaagga
agcaaggtgagggtgaaggctgttgtggagagaggaggaggaggaatctgcggcggagga
atcgcgggagattgcgtgaggaaggatttcgtcttcgagcctctctccgattattccaga
aacctatggcgccacaagctcggcgaatgcctcgattctctcggtcggcccaagaagttg
tttgtgtttgtgaacccatacggtggaaagaaatcagcgagaacgatcttccaggaggaa
gtaaagccattgttagaagctgcagatattcaacttgaggttaaagaaacaaagtatcag
ctgcatgccaaggaaattgtcagatccttggatcttgctgaatacgatggtatagtttgt
gtcagtggagatggtatccttgttgaggtggtaaatggattgctcgaaagagaagattgg
agaaacgctataagaacgccgattggaatgatccctggaggaaccggtaatggcatgata
aaatctctgttggactctgtcgggcttcagtgcagtgcgagaagtgctactatttctgta
attcgaggtcacaaacgttctctagacgtcgcaactatcttacaaggggacacgagattc
ttcagcatcttgatgctcgcttggggtctagtggctgatatagacatcgagtcagagaag
ttcagatggatgggcagtgctcggcttgacttttacgctcttcagagaataatacggttg
aggcgttataatggacgggttttatttgtgccggctcctgggtttgaaggctatggccag
ccggccagttatgaagccagatcccgtgccagttcagacaaagcgccatcagttgaagcc
aagaagctcgggtatcagggacctaacacagagaccagaaatcaagaatggagggaaata
aatggaccgtttgtttcagtatggcttcataatgttccgtggggtgccgagaacaccttg
gctgcacctgatgcgaagttttctgatggattcctggacttgattctcatcaaagactgt
cctaagcttgctctgttgtcactaatgacaaagttaaccgatggagggcatgttaaatct
ccctatacgatgtatctaaaggtgaaggaatttgtactggagccaggggcaagagtggaa
gatccggacaaggacgggatcatagattcagacggagaggttcttgcaaggggaaggaga
acgtataattccgaccacaaggctttgatgtcttacagtgagcttcgagttacagttgac
caaggtttagccacactcttctctcccaaataa

DBGET integrated database retrieval system