KEGG   Tarenaya hassleriana (spider flower): 104807488Help
Entry
104807488         CDS       T04125                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase Pin1-like
  KO
K09578  peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
thj  Tarenaya hassleriana (spider flower)
Brite
KEGG Orthology (KO) [BR:thj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:thj03021]
    104807488
   03110 Chaperones and folding catalysts [BR:thj03110]
    104807488
Enzymes [BR:thj01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     104807488
Transcription machinery [BR:thj03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     104807488
Chaperones and folding catalysts [BR:thj03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    104807488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase Rotamase_3 Rotamase_2
Motif
Other DBs
NCBI-GeneID: 104807488
NCBI-ProteinID: XP_010531077
Position
Unknown
AA seq 119 aa AA seqDB search
MAARDQVRASHILIKHQGSRRKASWKDPEGKIIMSTTRDAAVEQLRSIRADIVSGKANFE
EVAARVSDCSSAKRGGDLGPFGRGQMQKPFEEGTYSLKVGEISDIVDTDSGAHIIKRTA
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgagagaccaggttagggcttcgcacatactgataaagcaccagggatctcgg
aggaaagcgtcgtggaaggatccggagggaaagatcatcatgtccaccaccagagacgcc
gccgtcgagcagctcagatcgatccgcgcggacatcgtctccggcaaggctaacttcgag
gaggtcgcggctcgtgtctccgactgcagctccgccaagcgcggtggcgatctcggaccc
tttggaagaggccagatgcagaaaccgttcgaggaggggacatacagtctaaaagtgggc
gagataagcgacattgtcgacaccgacagtggtgcccacatcattaagagaaccgcctga

DBGET integrated database retrieval system