KEGG   Tarenaya hassleriana (spider flower): 104809262Help
Entry
104809262         CDS       T04125                                 

Definition
(RefSeq) uncharacterized protein LOC104809262
  KO
K06195  ApaG protein
Organism
thj  Tarenaya hassleriana (spider flower)
Brite
KEGG Orthology (KO) [BR:thj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    104809262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR Nefa_Nip30_N DUF4354
Motif
Other DBs
NCBI-GeneID: 104809262
NCBI-ProteinID: XP_010533487
Position
Unknown
AA seq 298 aa AA seqDB search
MSSSNVIFFNFETATMRCCCLRGREGSAFSDPGLWRGTSRVGSVRKNPTRRCRIFVACAA
DSEKNGGREHTNVGPDSDSERASGSLLSRSQTYALLKQKMDVAAKAENYEEAARIRLSLK
SLEDDEPVFRLKRMLKEAILEERFEDAARYRDKLNEIAPESLLKCTSDATTLGIRVQVRS
VYIEGRSQPLKGHYFFAYRIRITNNSDRPVQLLRRHWIITNTDGKTEHVRGVGVIGEQPV
ILPNTGFEYSSACPLTTPSGIMEGEFEMKHIDRIGAPSFNVVIAPFSLSVAGDASDIF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagttcttcgaacgttatcttttttaatttcgaaacggcaacgatgagatgttgctgt
ttacggggtcgggagggctccgcgttctcggatccgggcttatggagagggacgagtcgg
gtcgggtcggttcgtaagaatcccacgaggagatgcagaatctttgttgcgtgtgctgct
gattcggagaagaatggcgggagagagcataccaatgtcgggccggattcggactcggag
cgagcttcgggctcgttactgtcacggagccaaacctacgcgctgttgaaacagaaaatg
gatgttgccgccaaggctgagaactacgaagaagctgcgaggatacgactttctttgaaa
tcattagaagatgatgagccggttttccgactcaagaggatgttgaaagaggcaatcctt
gaggaaaggtttgaggatgctgctaggtaccgtgacaagctgaacgaaatagcgcccgag
tctcttctgaagtgtacaagtgatgcaactactttgggcatcagggttcaagttaggagt
gtttacattgaaggacgaagtcaaccactgaagggacattatttttttgcttatagaata
agaatcacgaacaactctgaccgtcctgtccaacttctgagacgtcattggattatcacc
aatactgatggcaaaacagagcatgtccgtggagttggcgttataggagaacagccagtt
atacttcctaatacaggctttgaatactcctccgcgtgcccgttaaccactcctagcggt
ataatggaaggcgagttcgaaatgaaacacatcgaccgaataggggcaccgtcctttaat
gtggtgatcgctccgtttagtctctccgtggcaggagatgcctcagatattttctga

DBGET integrated database retrieval system