KEGG   Tarenaya hassleriana (spider flower): 104809310Help
Entry
104809310         CDS       T04125                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK8-like isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
thj  Tarenaya hassleriana (spider flower)
Brite
KEGG Orthology (KO) [BR:thj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:thj01001]
    104809310
   01009 Protein phosphatases and associated proteins [BR:thj01009]
    104809310
Enzymes [BR:thj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104809310
Protein kinases [BR:thj01001]
 Serine/threonine kinases: Other
  Wnk family
   104809310
Protein phosphatases and associated proteins [BR:thj01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104809310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal OSR1_C SpoOE-like
Motif
Other DBs
NCBI-GeneID: 104809310
NCBI-ProteinID: XP_010533553
Position
Unknown
AA seq 603 aa AA seqDB search
MASGSGILCHKSPTKEVEFADKDPTGRYIRYGDILGKGAFKTVYKAFDEADGIEVAWNLV
VIEDVMQMPGQLERLYSEVHLLKSLKHENIIKLFHSWVDDKNKTINMITELFTSGSLRAY
RKTHKKVDPKAIKNWARQILQGLQYLHAQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLA
AVMQQPTARSVIGTPEFMAPELYEEEYNELVDIYSFGMCLLEMVTCEYPYSECRNQAQIY
KKVTSGIKPQSLSKVDDCQIKQFIEKCLLHASSRPTAIELLNDPFLATDGVKNSFCNVTS
NGTSKPVKQTQPEHLPMEMDHNDNKSVSVCSSLKSNHEYPWLHALELQRVAEDKEFRLRG
ERTDDVTASMTLRIADLSGTGQARIVHFAFYMNSDTATAIAEEMVEQLDLSSREVIVVSE
MIDELILKLISNRSQSISCDVSTHLNSLYASVQNSPNLPAGDNMNPRSKDQEAGGSVNSD
ISAEYYFAVTSNASCGRDWDIGYRVCDSYEGKNKKGALEVSRLAESLTSSLTFQDSCSVM
SKDSSMCCLSMLSNEQTEDLEAELSTIESQFQQSLQELMRLREEAIENAKRKWMKKQQEP
SPN
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctggttctggaattttatgtcacaaatcgccgacgaaggaggttgagttcgcc
gataaagatcctactggtcggtacattaggtatggtgacatcttggggaaaggagccttc
aaaactgtgtataaggcatttgatgaagctgatggaattgaagttgcctggaacctagtg
gtcatagaagatgtaatgcagatgcctggccaacttgaaaggctatattctgaagttcat
ctgcttaagtcgttgaaacatgaaaacattatcaaactcttccactcttgggtagacgat
aagaacaagaccatcaatatgatcacagagcttttcacctccggtagtctgagggcgtat
cgtaagacacacaagaaggttgatcccaaggccatcaagaactgggcaagacagattctt
caaggcttacagtatttgcatgctcagaacccccctgtaattcaccgggatcttaagtgt
gacaatatatttgtcaatggaaataccggagaggtcaaaattggagatcttgggcttgca
gcagttatgcagcaacccactgctcgaagcgttattggtactcccgaattcatggcaccc
gagctatatgaagaggaatacaatgagctcgttgacatctattctttcggtatgtgcttg
ttggagatggttacatgtgaatatccatacagtgaatgcagaaaccaggctcaaatatac
aagaaggttacctctggtataaagcctcaatctctcagcaaagtcgatgattgtcaaatt
aagcaattcatagaaaaatgtcttcttcatgcttcgtcgaggccaactgctattgagctc
ttgaatgacccgttcctggcaacagatggtgttaagaactctttctgtaacgtgacatcc
aatggaacttctaaacctgtcaaacagacccaacctgaacatctgcccatggaaatggat
cataacgataataaaagtgtttctgtttgctcctctcttaaaagcaaccatgaataccct
tggcttcacgctcttgaacttcagagggttgcagaggataaagagttcaggttgagaggg
gagagaactgatgatgtcacggcctcgatgactctgcgtatcgctgatctatctggtaca
ggtcaagctagaatcgtgcattttgcattctatatgaattcggacacagcaactgcaatt
gcagaggaaatggttgaacagcttgatctatcaagccgagaggttatagtcgtatctgag
atgatcgatgaattgatattgaagctgatctctaacaggagccagtccatatcctgtgac
gtttcaactcatttgaacagtttgtatgcatcggttcaaaattctcctaatctacctgct
ggagataacatgaatccgcggtcaaaggatcaagaagctggaggatcagtgaattcagac
atatctgccgagtactactttgctgtcacctcaaatgccagctgtggccgggattgggat
atcgggtatcgggtgtgtgattcatacgaggggaagaacaagaagggcgcactggaagtt
tctcggctggcagagtctctgacaagctcgctgacgtttcaagattcatgctcggtgatg
tcaaaagactcgagcatgtgctgtttgtcgatgttgagcaatgaacagacggaggatctg
gaggcggagctcagcacaatagagtcgcagtttcaacagtcgttgcaggagcttatgagg
ttgagagaagaagctatagagaatgcgaaacggaagtggatgaagaagcagcaggagccc
tctcccaactaa

DBGET integrated database retrieval system